DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Cphx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:165 Identity:45/165 - (27%)
Similarity:71/165 - (43%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 TEDDQARLILKRKLQRN---RTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWF 519
            |:|:::: ..||...||   |..|:.|::..|::||....|||...::.||.:.....:.|..||
Mouse    12 TKDNRSK-ARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSVIDNWF 75

  Fly   520 SNRRAKWRREEK-----LRNQRRTPN--STGASATSSSTSATASLTDSPNSLSACSSLLSGSAGG 577
            .|:||:...|.|     :|..||..:  .||...|....:       |....|:|.|::. |.|.
Mouse    76 QNKRARLAPELKSKISAMRRMRRCQDYMRTGHQDTQPPKA-------SGEQYSSCDSVVR-SIGR 132

  Fly   578 PSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPT 612
            .|:.|:....:              ||.:||..||
Mouse   133 QSIGTVEHQGA--------------AGRESSFRPT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 17/51 (33%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.