powered by:
Protein Alignment ey and LOC101731251
DIOPT Version :9
Sequence 1: | NP_001014693.1 |
Gene: | ey / 43812 |
FlyBaseID: | FBgn0005558 |
Length: | 898 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017951762.1 |
Gene: | LOC101731251 / 101731251 |
-ID: | - |
Length: | 882 |
Species: | Xenopus tropicalis |
Alignment Length: | 30 |
Identity: | 10/30 - (33%) |
Similarity: | 17/30 - (56%) |
Gaps: | 2/30 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 YYHLTDDECHSGVNQLGGVFVGGRPLPDST 118
|.:..|:| :|:..|.|..:.|..||::|
Frog 304 YIYDPDEE--AGLPHLVGSLIKGELLPEAT 331
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.