DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and LOC101731251

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_017951762.1 Gene:LOC101731251 / 101731251 -ID:- Length:882 Species:Xenopus tropicalis


Alignment Length:30 Identity:10/30 - (33%)
Similarity:17/30 - (56%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YYHLTDDECHSGVNQLGGVFVGGRPLPDST 118
            |.:..|:|  :|:..|.|..:.|..||::|
 Frog   304 YIYDPDEE--AGLPHLVGSLIKGELLPEAT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 7/21 (33%)
Homeobox 475..527 CDD:278475
LOC101731251XP_017951762.1 DD 27..105 CDD:387368
FISNA 123..196 CDD:373091
P-loop_NTPase 208..373 CDD:393355 10/30 (33%)
NOD2_WH 449..506 CDD:375327
NLRC4_HD2 508..609 CDD:375325
LRR_RI <618..>770 CDD:393385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.