DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and lmx1b.1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002937918.1 Gene:lmx1b.1 / 100495130 XenbaseID:XB-GENE-494750 Length:400 Species:Xenopus tropicalis


Alignment Length:210 Identity:53/210 - (25%)
Similarity:82/210 - (39%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 DIHLKKEL------DGHQSDETGSGEGENSNGGAS-NIGNTEDDQARLILKRKLQRNRTSFTNDQ 482
            |...:|:|      |...|.::...||:...|... |.|...||...   .|:.:|.||..|..|
 Frog   168 DYEKEKDLLSSGSPDDSDSVKSDDEEGDVKPGKCHVNQGKGSDDGKD---PRRPKRPRTILTTQQ 229

  Fly   483 IDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR-------EEKLRNQRRTPN 540
            ..:.:..||.:..|....||.||.:.||....:||||.|:|||.::       :::.:|.:|...
 Frog   230 RRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQ 294

  Fly   541 STGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVST---INGLSSPSTLSTNVNA---P 599
            ...:|......::.|.|......:.....        .|.||   ..||:.|.....::|.   .
 Frog   295 EVMSSRMEGMMTSYAPLAPPQQQIVTMDQ--------NSYSTDPFQQGLTPPQMPGDHMNPYGND 351

  Fly   600 TLGAGIDSSESPTPI 614
            |:...|||..|.|.:
 Frog   352 TIFHDIDSDTSLTSL 366

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
lmx1b.1XP_002937918.1 LIM1_Lmx1b 56..108 CDD:188757