DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and hoxb8

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 / 100493882 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis


Alignment Length:179 Identity:43/179 - (24%)
Similarity:74/179 - (41%) Gaps:38/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 GPSLAHSLSPPNDIE-------SLASIGHQRN-----C-----------PVATEDIHLKKELDGH 435
            |.|...:...|..|:       ||:|..:|:|     |           |:..:.:...::.:..
 Frog    41 GASAGGTFQHPGQIQDFYHGTPSLSSPTYQQNPCAVTCHGDPGSFYGYDPLQRQSLFSSQDTELV 105

  Fly   436 QSDE---TGSGEGENSNGGASNIGNTE-----DDQARLILKRKLQRNRTSFTNDQIDSLEKEFER 492
            |..|   ..:|.||.:.....:...|:     ..||    ....:|.|.:::..|...|||||..
 Frog   106 QYSECKLASAGLGEEAESSEQSPSPTQLFPWMRPQA----AAGRRRGRQTYSRYQTLELEKEFLF 166

  Fly   493 THYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNS 541
            ..|.....|..::..:||.|.::::||.|||.||::|   .|:.:.|:|
 Frog   167 NPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKE---NNKDKFPSS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
hoxb8XP_002938067.1 Homeobox 149..202 CDD:365835 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.