DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and hoxc13

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002936691.1 Gene:hoxc13 / 100487255 XenbaseID:XB-GENE-478832 Length:306 Species:Xenopus tropicalis


Alignment Length:336 Identity:72/336 - (21%)
Similarity:122/336 - (36%) Gaps:99/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 NSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNSSESGGASNSGEGSEQEAIYEKLRL 307
            |..:.:.|.::.|...|.||      |...|.:       |..:.|..:|..||.|..:|..   
 Frog    24 NEKNPRKSPAMEGLSGNCAS------SHCRDFI-------SHPALGRHSSAIGSHQGPVYTD--- 72

  Fly   308 LNTQHAAGPGPLEPARAAPLVGQS----PNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGS 368
            :.:..||......|:.:...:|.:    .::.|.|.|....|:       .||:   |..::...
 Frog    73 ITSPEAARQCTAPPSSSNASLGYAYPFGSSYYGCRLSQSHNVN-------LHQK---PCSYHPAE 127

  Fly   369 WYPTSLSEIP----ISSAPNIASVTAYASG-------------PSLAHSLSPPNDIESLASI-GH 415
            .||...:.:|    .|.|...|...::||.             |.::....|.:|  :|.|: |:
 Frog   128 KYPEPSNPLPSEEFSSRAKEFAFYPSFASSYQAVPGYLDMSVVPGISSHPEPRHD--TLLSMEGY 190

  Fly   416 QRNCPVATEDIH--LKKELDGH---QSDETGSG-------------EGENSNGGASNIGNTEDDQ 462
            |          |  |....||.   ..|::.||             :.|.||             
 Frog   191 Q----------HWALPNGWDGQVYCSKDQSQSGHLWKAPFPDVVPLQPEVSN------------- 232

  Fly   463 ARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWR 527
                 .|:.::.|..:|..|:..||||:..:.:.....|.|::....|.|.::.:||.|||.|  
 Frog   233 -----YRRGRKKRVPYTKIQLKELEKEYAASKFITKEKRRRISTATSLSERQVTIWFQNRRVK-- 290

  Fly   528 REEKLRNQRRT 538
             |:|:..:.:|
 Frog   291 -EKKVVTKCKT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 17/51 (33%)
hoxc13XP_002936691.1 HoxA13_N 31..142 CDD:372013 28/136 (21%)
Homeobox 239..293 CDD:365835 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.