DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and phox2a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001239128.1 Gene:phox2a / 100486496 XenbaseID:XB-GENE-853857 Length:281 Species:Xenopus tropicalis


Alignment Length:249 Identity:81/249 - (32%)
Similarity:110/249 - (44%) Gaps:55/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 TAYASGPSLAHSLSPPNDIE---SLASIGHQRNCPVATEDIHLKKELDGHQ------------SD 438
            :|||.    ..|.|.||..:   ...|.|....||..|........|..||            ||
 Frog    22 SAYAD----FSSCSQPNSFQYNPIRGSFGANPACPPLTTANCTLGALRDHQPSPYSTVPYKFFSD 82

  Fly   439 ETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARER 503
            .:|..|                       |||.:|.||:||:.|:..||:.|..|||||::.||.
 Frog    83 PSGINE-----------------------KRKQRRIRTTFTSSQLKELERVFAETHYPDIYTREE 124

  Fly   504 LAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACS 568
            ||.||.|.|||:||||.|||||:|::|:..|.:...::.|.|....|...::| .|..:..|.||
 Frog   125 LALKIDLTEARVQVWFQNRRAKFRKQERAANSKSGSSNNGGSGNKKSDPRSSS-EDDESKESNCS 188

  Fly   569 SLLSGSAGGPSVSTIN----GLS-SPSTLSTNVNAPTLGA-------GIDSSES 610
            .....:|..|:...:|    .|| ||..:|..|:|.|:.|       |:.:|.|
 Frog   189 PTPDSTASLPTAGNLNSPGGSLSPSPGAVSGLVSAHTVQALKGPAWPGVPTSSS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
phox2aNP_001239128.1 Homeobox 96..148 CDD:278475 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.