DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and shox

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:155 Identity:54/155 - (34%)
Similarity:85/155 - (54%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 TAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGAS 453
            |..|....|.:|.:...||...::     :||     :||.||   |.:|   |.:.:..:.|::
 Frog    79 TGLARVRELGNSETNLQDITDTSN-----HCP-----LHLYKE---HGAD---SDKDKLKDYGST 127

  Fly   454 NIG-------------NTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLA 505
            .:.             .:||:..:..||::  |:||:||.:|::.||:.|:.|||||.|.||.|:
 Frog   128 RVSEGIYECKEKRDDVKSEDEDGQTKLKQR--RSRTNFTLEQLNELERLFDETHYPDAFMREELS 190

  Fly   506 GKIGLPEARIQVWFSNRRAKWRREE 530
            .::||.|||:||||.|||||.|::|
 Frog   191 QRLGLSEARVQVWFQNRRAKCRKQE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 31/51 (61%)
shoxXP_004911874.1 Homeobox 159..213 CDD:365835 31/53 (58%)
OAR 314..330 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.