DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pax9

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002935394.1 Gene:pax9 / 100485934 XenbaseID:XB-GENE-482238 Length:360 Species:Xenopus tropicalis


Alignment Length:391 Identity:140/391 - (35%)
Similarity:187/391 - (47%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIG 165
            |||||||||.|||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.|||
 Frog     8 VNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIG 72

  Fly   166 GSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLR----NLAAQ 226
            ||||||.|..||..|..||:..|.|||||||||||.:.||...|:||||||:|:||    |||.|
 Frog    73 GSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQ 137

  Fly   227 KEQQSTGSGSSSTSA---------GNSISAKVSV-------SIGGNV--------SNVASGSRGT 267
            ...:|.....::.||         .:.|:|...|       ||.|.:        |:..:...| 
 Frog   138 NHYESHKQHPAAASALPYNHLYSYPSPIAAGAKVPTPPGMPSIPGTMGMPRTWPSSHSVTDILG- 201

  Fly   268 LSSSTDLMQTATP-----------LNSSESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEP 321
            :.|.||.:...:|           |:.:....|.:...|.|:.::.::::.  :|.|:|...:..
 Frog   202 IRSITDQVSDTSPYPSPKLEEWSSLSRNTFQSAQHVLNGLEKSSLEQEVKY--SQSASGLPAVSG 264

  Fly   322 ARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPIS--SAPN 384
            ..||.  |.:|                                     |||:   .|:|  .|.:
 Frog   265 FVAAS--GMTP-------------------------------------YPTT---APVSPYMAYS 287

  Fly   385 IASVTAYASGPSLAHS----LSPPN-DI-ESLASIGHQ--RNCPVATEDIHLKKELDGHQSDETG 441
            .|:.|.|.:|....|:    |||.: || .|||..|..  |....:...||.:|....:.:...|
 Frog   288 TAAPTGYVTGHGWQHTGGTPLSPHSCDITASLAFKGMHTAREAEESKLSIHTRKSPQSYHTQRHG 352

  Fly   442 S 442
            :
 Frog   353 T 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 83/119 (70%)
Homeobox 475..527 CDD:278475
pax9XP_002935394.1 PAX 6..131 CDD:238076 85/122 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.