DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and LOC100485335

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:245 Identity:106/245 - (43%)
Similarity:135/245 - (55%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 QSDET--------GSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFER 492
            ||:.|        .|.:.|:..|.|::  :.::.|.||.|||||||||||||.:||::|||||||
 Frog    35 QSNTTIDSCQQLDSSLDSEHQPGAAND--DLDESQIRLQLKRKLQRNRTSFTQEQIEALEKEFER 97

  Fly   493 THYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGA--SATSSSTSAT- 554
            |||||||||||||.||.||||||||||||||||||||||||||||..::|.:  |..||.:|:. 
 Frog    98 THYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTSSHLSINSSFSSSVY 162

  Fly   555 -----------------ASLTDS------------PNSL---------SACSSLLSGSAGGPSVS 581
                             |::|:|            ||:|         |..|.::|.|   ||||
 Frog   163 QSIPQPSNSGSMLGRSEAAITNSYGSLPPLPSFTMPNNLPIQPIASQTSTYSCMISSS---PSVS 224

  Fly   582 TIN-GLSSPSTLSTNVNAPTLGAGIDSSES--------PTPIPHIRPSCT 622
            ..: ...:|..|.|:::...||:|..||..        |..:|...|..|
 Frog   225 VRSYDAYTPPQLQTHMSNQNLGSGASSSTGLISPGVSVPVQVPGGDPDLT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 45/51 (88%)
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835 46/52 (88%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6336
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152885at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.