DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and nkx2-5

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001116891.1 Gene:nkx2-5 / 100144646 XenbaseID:XB-GENE-487966 Length:300 Species:Xenopus tropicalis


Alignment Length:310 Identity:62/310 - (20%)
Similarity:111/310 - (35%) Gaps:99/310 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 LQQHQQQSWP----PRHYSGSWYPTSLSEIPISSAPNIASVTA------YASGPS---------- 396
            |:|||....|    .|..:.|...::..:.|....|.::.:|.      .:.|||          
 Frog    19 LEQHQSGLSPMDITSRLENSSCMLSTFKQEPYPGTPCLSELTEELAQRDSSKGPSPFPGSFFVKN 83

  Fly   397 ---LAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNT 458
               :..|..|.:|.:.:        ||:.....|.|:|.:                         
 Frog    84 YLEMDSSKDPKDDKKDI--------CPLQKTLEHDKREAE------------------------- 115

  Fly   459 EDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRR 523
            :.::.|   :||.::.|..|:..|:..||:.|::..|.....|:.||..:.|...::::||.|||
 Frog   116 DPERPR---QRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLTSTQVKIWFQNRR 177

  Fly   524 AKWRREEK--------LRNQRR---------------------TPNSTGASATSSSTSATASLTD 559
            .|.:|:.:        |...||                     :|.:...:..|.:|....|...
 Frog   178 YKCKRQRQDQTLEMVGLPPPRRIAVPVLVRDGKPCLGESSPYNSPYNVSINPYSYNTYPAYSNYS 242

  Fly   560 SPN-------SLSACSSLLSGSAGGP----SVSTINGLSSPSTLSTNVNA 598
            :|.       |.|:..|:...|||..    ||..:|.:.:|...::.|:|
 Frog   243 NPACSGSYNCSYSSMPSMQPTSAGNNFMNFSVGDLNTVQTPIQQASGVSA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 17/51 (33%)
nkx2-5NP_001116891.1 Homeobox 132..182 CDD:365835 16/49 (33%)
COG5576 <133..235 CDD:227863 21/101 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.