DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and ventx1.1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001107707.1 Gene:ventx1.1 / 100101668 XenbaseID:XB-GENE-920501 Length:277 Species:Xenopus tropicalis


Alignment Length:189 Identity:55/189 - (29%)
Similarity:79/189 - (41%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SLSEIP-ISSAPNIASVTAYA-------------SGPSLAHSLSPPND---IESLASIGHQRNCP 420
            |:|..| |..||...:.|.||             ...|...||....|   ..|.:|....||  
 Frog    25 SVSSRPHIPCAPQPLAPTKYAKEIPRRKDGQEQGDATSFQSSLGKHGDKLHYSSPSSAALHRN-- 87

  Fly   421 VATEDIHLKKELDGHQSDETGS--GEGENSNGGASNIGN---TEDDQARLILKRKLQRN-RTSFT 479
                         ...|||..|  .|.::::|..|.:.|   ||.|......|..|||. ||:||
 Frog    88 -------------WGSSDEFSSAGSEDDSTDGFPSPVRNSQETETDCRGKSPKSDLQRRLRTAFT 139

  Fly   480 NDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRT 538
             .||..||:.|.:..|.....|::||..:.|.|.:::.||.|||.|.:|:  :::|:.:
 Frog   140 -PQISRLEQAFNKQRYLGASERKKLATSLRLSEIQVKTWFQNRRMKLKRQ--IQDQQHS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
ventx1.1NP_001107707.1 Homeobox 135..186 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.