DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and rax

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002936715.1 Gene:rax / 100038124 XenbaseID:XB-GENE-492665 Length:326 Species:Xenopus tropicalis


Alignment Length:330 Identity:98/330 - (29%)
Similarity:144/330 - (43%) Gaps:109/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 NIASVTAYASGPSLAHS----LSPPN--DIESLASIGHQRNC-PVATEDIHLKKELDGHQSDETG 441
            :|.::..::...|:..|    :||.|  :::..:|    |:| ...||:||.::|   |..|...
 Frog    33 SIEAILGFSKEDSVLGSFQTEVSPRNAKEVDKRSS----RHCLHKMTEEIHPQQE---HLEDGQS 90

  Fly   442 SGEGENSNG---------GASNIGNTE----DDQARLILKRKLQRNRTSFTNDQIDSLEKEFERT 493
            .|.|:..:|         |.|...|::    ||:.:  .|:|.:||||:||..|:..||:.||::
 Frog    91 DGYGDPYSGKTSSECLSPGLSTSNNSDNKLSDDEQQ--PKKKHRRNRTTFTTYQLHELERAFEKS 153

  Fly   494 HYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLR------------NQRRTPNSTGASA 546
            |||||::||.||.|:.|||.|:||||.||||||||:|||.            :..|:|..:..||
 Frog   154 HYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVTSMKLQDSPILSFNRSPQPSAMSA 218

  Fly   547 TSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESP 611
            .|||....:.||.|.::.:|..||       |...|     ||.:|               ..|.
 Frog   219 ISSSLPLDSWLTPSISNSTALQSL-------PGFVT-----SPPSL---------------PGSY 256

  Fly   612 TPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNTHHIQSNGHAQGHALVP--AISPRLN 674
            ||.|.|.|:                                       :.||||.|  |:.|...
 Frog   257 TPPPFINPA---------------------------------------SVGHALQPLGAMGPPPP 282

  Fly   675 FNSGS 679
            :..|:
 Frog   283 YQCGA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
raxXP_002936715.1 Homeobox 135..188 CDD:365835 33/52 (63%)
OAR 299..315 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.