DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and nkx2-6

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_002932599.1 Gene:nkx2-6 / 100038094 XenbaseID:XB-GENE-486951 Length:254 Species:Xenopus tropicalis


Alignment Length:263 Identity:64/263 - (24%)
Similarity:101/263 - (38%) Gaps:65/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 PISSAP-NIASVTAYASG-----PSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGH- 435
            |.:|.| ::..:....:|     |..:|..:.|      ..||..|..|:..:     :|..|. 
 Frog     5 PATSTPFSVKDILRLENGQVGSAPVRSHPGTDP------LLIGAARRDPIERD-----RESPGAF 58

  Fly   436 -QS----DETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHY 495
             ||    |...:.|.....||....|..|.     :..|:.::.|..|:..|:..||:.|::..|
 Frog    59 CQSPQIEDPDFAQEQSGYFGGLGRGGPQEQ-----LHHRQRRKPRVLFSQMQVFELERRFKQQRY 118

  Fly   496 PDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRN--------QRRT-------------- 538
            .....||:||..:.|...::::||.|||.|.:|:::.|:        .||.              
 Frog   119 LSAPEREQLALALKLTSTQVKIWFQNRRYKCKRQKQDRSLELGHPIPPRRVAVPVLVRDGKPCLG 183

  Fly   539 PNSTGASATSSSTSATASLTDSPNSLSACSSLLSGS---AGGPSVSTINGLSSPSTLSTNVNAPT 600
            |..|.||  ..:.|||      |.:...|....:.|   :|.|||.|:..    ..:|.|..|..
 Frog   184 PTQTFAS--PYNVSAT------PYTYPVCYGNYTNSPYYSGAPSVPTMGS----QLISMNTTAVP 236

  Fly   601 LGA 603
            .||
 Frog   237 SGA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
nkx2-6XP_002932599.1 Homeobox 97..151 CDD:365835 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.