DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and gdf10b

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001165060.2 Gene:gdf10b / 794493 ZFINID:ZDB-GENE-120316-1 Length:385 Species:Danio rerio


Alignment Length:256 Identity:50/256 - (19%)
Similarity:92/256 - (35%) Gaps:93/256 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FSNSSNNDSPEMVMLSNETNNSAKVLSEKNGSSSIS------ADDKINENMGI--------FQMK 153
            :..:|..:..|..::.|.:::|...|.||:..|...      .:.|::.|..:        |:.|
Zfish   151 YERASLEEEFEYTIILNPSSSSVPHLQEKSSHSCFEDELGYLCETKVHVNQSVVVQWVVLKFEGK 215

  Fly   154 VQSKPGKKSTPLAKVSEHGDLSRVQSVSLYRNTLINIESMLQRQLR-EKAKVDSIESIKMHILMR 217
            :.|.|                     |..|:|..:       .||. ..||.:.|.:|....:..
Zfish   216 IASIP---------------------VHTYKNVSV-------PQLEPASAKTEWIAAILCGSIAL 252

  Fly   218 L------------NLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDTY 270
            |            |..|:|.:.   |:.:||:...|        :|.:::.||   .|:| :.|.
Zfish   253 LFIVFVVLWFIHKNFSKIPKVP---SILRNIVTRPY--------STPYSQPES---PHVS-SMTS 302

  Fly   271 GDHIMTDFFDESSSSQMQGDDANTVNEFLID-LNKNQAKKSDIPINT-------NDEEYES 323
            ..|.....::               ||.|:| ::...:|.:|..:||       ::|||:|
Zfish   303 ATHTPVLLYN---------------NEPLLDFVHDEVSKTTDTLVNTEEEEPAPSEEEYDS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448
gdf10bNP_001165060.2 FN3 21..104 CDD:328772
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.