DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Gdf10

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_077351.1 Gene:Gdf10 / 79216 RGDID:621512 Length:476 Species:Rattus norvegicus


Alignment Length:296 Identity:77/296 - (26%)
Similarity:115/296 - (38%) Gaps:92/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 QIDSSYSDLS-------------YA---------TLHLYLRGWDWISA--HQPGLLEEIKKQPRK 394
            |:||...||.             ||         ::.:.|:.:|...|  .:||........|| 
  Rat   220 QLDSGEKDLGVPRPSSHMPYILVYANDLAISEPNSVAVTLQRYDPFPAGDFEPGAAPNSSADPR- 283

  Fly   395 DIVVTIHRAIRVANTTSFN----------PKVKMFEF-RHSIPSGLGQWVAVDLKSLLGNLGSNM 448
                 :.||.:|:.....|          |.:....| :|..      | :...::|....|...
  Rat   284 -----VRRAAQVSKPLQDNELPGLDERPAPALHAQHFHKHEF------W-SSPFRALKPRTGRKD 336

  Fly   449 TQEILIKGAETWMKSLVVTTDNTSKNPLTVHIEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLK 513
            .::   |..:|:..|.....|...|.         .||..||         :.|....|.|..||
  Rat   337 RKK---KDQDTFTPSSSQVLDFDEKT---------MQKARRR---------QWDEPRVCSRRYLK 380

  Fly   514 VNFTSFGWH-FVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALTTSAT----------------P 561
            |:|...||: ::::|.|||||:|:|.|      ::|...:...:..||                |
  Rat   381 VDFADIGWNEWIISPKSFDAYYCAGAC------EFPMPKIVRPSNHATIQSIVRAVGIVPGIPEP 439

  Fly   562 CCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            ||.|.||:||.:|:.|:|.|:||.|.||||||.|:|
  Rat   440 CCVPDKMNSLGVLFLDENRNVVLKVYPNMSVETCAC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 42/107 (39%)
Gdf10NP_077351.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..305 8/42 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..358 5/30 (17%)
TGF_beta 372..475 CDD:278448 42/108 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.