DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and bmp3

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001071233.1 Gene:bmp3 / 777717 ZFINID:ZDB-GENE-030131-7192 Length:452 Species:Danio rerio


Alignment Length:467 Identity:114/467 - (24%)
Similarity:176/467 - (37%) Gaps:149/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 YNASSKTTVW---------NRMESIDESHL--SINDTYGDHIMTDFFDESSSSQMQGDDANTVNE 297
            |.|..||.|.         .:.|..::.|:  |..||..:| |...:.:.:|:.....|.|||..
Zfish    21 YCAVLKTPVMGFSKDVQLGQKAEEPEKQHVKKSEQDTLSEH-MQMLYAKYTSAGFPLKDGNTVRS 84

  Fly   298 F---LIDLNKNQAKKSDIPINTNDEEYESILSH--ISSIYIFPEEIQPH---VRHNRK------V 348
            |   |..:|..|.:..::...|..|:..|...|  |..::........|   .:||.:      :
Zfish    85 FKGHLGTINNRQLQIFNLTSLTKSEDVLSATLHYYIGDLHNSSHRCSKHKSCAQHNLRRQAHVHL 149

  Fly   349 DVFRFQIDSS------YSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTIHRA---- 403
            ||:.|.:..:      :..::.:|:|.....|.|                 |||...:::|    
Zfish   150 DVWSFSLVKNTTRTIGHFPINISTMHWDFISWQW-----------------KDITRVVNQAKHHD 197

  Fly   404 -----IRVANTTSFNPKVKMFEFRH------------SIPSGLGQWVAVDLKSLLGNL------- 444
                 |.: |:....|..|:...|.            |.|..:...:......||.||       
Zfish   198 QLLIGINI-NSRGHQPWKKLLSDRSPYILVYANDSAISEPESVVSTLQRHKSRLLPNLHMLESHN 261

  Fly   445 -------GSNMTQEIL-------IKGAE------TW--------MKSLVVTTDNTS-------KN 474
                   .|..:..||       :.|.|      ||        |:|..|......       ||
Zfish   262 RNASAQHRSRRSTNILLPLQNNELPGPEYPYEIPTWDEASPYDPMESKTVKRPRKKPRKNPRHKN 326

  Fly   475 PLTVHIEIGSQ--KKHRRKRSVYMDCTENDHDMRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCS 536
            ||   ::...|  ||.|:|        :.:....|.|..|||:|...|| .::::|.|||||:||
Zfish   327 PL---LQFDEQTIKKARKK--------QWNEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCS 380

  Fly   537 GDCKVGYLEQYP---------HTHLAALTTSA-------TPCCSPTKMSSLSLLYFDDNHNLVLS 585
            |.|      |:|         |..:.::..:.       .|||.|.||||||:|:||::.|:||.
Zfish   381 GSC------QFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDEDKNVVLK 439

  Fly   586 VIPNMSVEGCSC 597
            |.|||:|:.|:|
Zfish   440 VYPNMTVDSCAC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 43/107 (40%)
bmp3NP_001071233.1 TGFB 350..452 CDD:214556 44/108 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.