DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and TGFB3

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens


Alignment Length:482 Identity:97/482 - (20%)
Similarity:156/482 - (32%) Gaps:191/482 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 KVDSIESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSIN 267
            |...:|:|:..||.:|.|...|..|....||..::    ..||::        .|.::|.|    
Human    36 KKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL----ALYNST--------RELLEEMH---- 84

  Fly   268 DTYGDHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIY 332
               |:.      :|..:.:                            ||..|.|      ...|:
Human    85 ---GER------EEGCTQE----------------------------NTESEYY------AKEIH 106

  Fly   333 IFPEEIQPHVRHNRKV--------DVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIK 389
            .| :.||....||...        .||||.:.|                              ::
Human   107 KF-DMIQGLAEHNELAVCPKGITSKVFRFNVSS------------------------------VE 140

  Fly   390 KQPRKDIVVTIHRAIRVANTTS--FNPKVKMFEF----RH----------SIPS-GLGQWVAVDL 437
            |. |.::.....|.:||.|.:|  ...::::|:.    .|          ::|: |..:|::.|:
Human   141 KN-RTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDV 204

  Fly   438 KSLL--------GNLGSNMT---------------------QEILIKGAETWMKSLVVTTDNTSK 473
            ...:        .|||..::                     .||..||.:        ..|:..:
Human   205 TDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVD--------NEDDHGR 261

  Fly   474 NPLTVHIEIGSQKKH-----------------------RRKRSVYMDCTENDHDMRCCRYPLKVN 515
            ..|.   .:..||.|                       |:||::..:....:.:..||..||.::
Human   262 GDLG---RLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYID 323

  Fly   516 F-TSFGWHFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAAL--------TTSATPCCSPTKMSSL 571
            | ...||.:|..|..:.|.||||.|.  ||.....||...|        ..||:|||.|..:..|
Human   324 FRQDLGWKWVHEPKGYYANFCSGPCP--YLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPL 386

  Fly   572 SLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            ::||:......| ..:.||.|:.|.||
Human   387 TILYYVGRTPKV-EQLSNMVVKSCKCS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 34/99 (34%)
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 49/284 (17%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.