DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and TGFB2

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001129071.1 Gene:TGFB2 / 7042 HGNCID:11768 Length:442 Species:Homo sapiens


Alignment Length:488 Identity:100/488 - (20%)
Similarity:189/488 - (38%) Gaps:131/488 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SVSLYRNTLINIESMLQRQLREKAKVDSIESIKMHILMRLNLKKLP-NITKPISVPQNIID--NF 240
            ::||...:.::::..::::         ||:|:..||.:|.|...| :..:|..||..:|.  |.
Human    18 ALSLSTCSTLDMDQFMRKR---------IEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISIYNS 73

  Fly   241 YRDY---NASSKTTVWNRMESIDESHLSINDTYGDHI----MTDFFDESSSSQMQGDDANTVNEF 298
            .||.   .||.:.....| |..||.:      |...:    |..||...:...:....:.:|...
Human    74 TRDLLQEKASRRAAACER-ERSDEEY------YAKEVYKIDMPPFFPSETVCPVVTTPSGSVGSL 131

  Fly   299 LIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQI---DSSYS 360
            .       :::|.:           :..::.:|.  |...:|:.|      :.||.:   :.:.|
Human   132 C-------SRQSQV-----------LCGYLDAIP--PTFYRPYFR------IVRFDVSAMEKNAS 170

  Fly   361 DLSYATLHLYLRGWDWISAHQPGLLEEIK-KQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHS 424
            :|..|...::             .|:..| :.|.:.|  .:::.::..:.||  |..:..:.:..
Human   171 NLVKAEFRVF-------------RLQNPKARVPEQRI--ELYQILKSKDLTS--PTQRYIDSKVV 218

  Fly   425 IPSGLGQWVAVDLKSLL--------GNLG--------------------SNMTQEIL-----IKG 456
            .....|:|::.|:...:        .|||                    .|.::|:.     |.|
Human   219 KTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDG 283

  Fly   457 AETW----MKSLVVT-TDNTSKNP-----LTVHIEIGSQKKHRRKR----SVYMDCTENDHDMRC 507
            ..|:    .|::..| ..|:.|.|     |.....:.||:.:|||:    :.|  |..|..| .|
Human   284 TSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAY--CFRNVQD-NC 345

  Fly   508 CRYPLKVNF-TSFGWHFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAAL------TTSATPCCSP 565
            |..||.::| ...||.::..|..::|.||:|.|...:.....|:.:.:|      ..||:|||..
Human   346 CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVS 410

  Fly   566 TKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            ..:..|::||: ......:..:.||.|:.|.||
Human   411 QDLEPLTILYY-IGKTPKIEQLSNMIVKSCKCS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 27/97 (28%)
TGFB2NP_001129071.1 TGFb_propeptide 21..256 CDD:395559 50/293 (17%)
TGF_beta_TGFB2 345..441 CDD:381655 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.