DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Inhbc

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_072136.1 Gene:Inhbc / 64549 RGDID:621194 Length:351 Species:Rattus norvegicus


Alignment Length:414 Identity:86/414 - (20%)
Similarity:153/414 - (36%) Gaps:128/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 IESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDTYG 271
            ::..|..||.:|:|.:.|.:::|:|              ..:..|...|:.......|..:|...
  Rat    44 LDLAKKSILDKLHLSQRPILSRPVS--------------REALKTALRRLRGTRAETLLEHDQRQ 94

  Fly   272 DHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPE 336
            ::.:..|.|...|:         :|:..::.:.:......:.:             :.:.::|..
  Rat    95 EYEIISFADTGLSN---------INQTRLEFHFSDRTTGGVEV-------------LQTRFMFFM 137

  Fly   337 EIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTIH 401
            ::.|:......:.|                  |.||.:|                  .::.:|..
  Rat   138 QLPPNTTQTMNIRV------------------LVLRPYD------------------TNLTLTSQ 166

  Fly   402 RAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLG------SNMTQEILIKGAETW 460
            ..::|.                  .||   |..:    |||...      .::|.| |:..::..
  Rat   167 YMLQVD------------------ASG---WYQL----LLGPEAQAACSQGHLTLE-LVPESQLA 205

  Fly   461 MKSLVVTTDNTSKNPLTVHIEIGSQKKHR-RKRSVYMDCTENDHDMRCCRYPLKVNFTSFGWH-F 523
            ..||::  |..|..|. |..::..:.||| |:|.:  :|  ......|||....|:|...||| :
  Rat   206 HSSLIL--DGVSHRPF-VAAQVRVEGKHRVRRRGI--NC--QGLSRMCCRQEFFVDFREIGWHDW 263

  Fly   524 VVAPTSFDAYFCSGDCKVGYLEQYP------HTH----LAALTTSAT----PCCSPTKMSSLSLL 574
            ::.|..:...||:|.|.: ::...|      ||.    |.|.|.:.|    .||.||....||||
  Rat   264 IIQPEGYAMNFCTGQCPL-HVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLL 327

  Fly   575 YFDDNHNLVLSVIPNMSVEGCSCS 598
            |:|.:.|:|.:.||:|.||.|.||
  Rat   328 YYDRDSNIVKTDIPDMVVEACGCS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 38/105 (36%)
InhbcNP_072136.1 TGF_beta_INHBC_E 246..351 CDD:381676 38/105 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.