DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and inha

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001038669.1 Gene:inha / 570520 ZFINID:ZDB-GENE-060503-554 Length:347 Species:Danio rerio


Alignment Length:144 Identity:38/144 - (26%)
Similarity:62/144 - (43%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 DNTSKNPLTVHIEIGSQKKHRRKRSVYM----DCTEN-----DHDMRCCRYPLKVNFTSFGW-HF 523
            |:..|.|. :|:...|....|.:|:..:    |..||     .....|.|..::::|...|| ::
Zfish   214 DSEDKTPF-LHLHTRSSGPDRSRRAPKIPWSPDAIENLKRPASQGTDCRREQIEISFEDLGWNNW 277

  Fly   524 VVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALTT--SATPCCSPTKMSSLSLLY---FDDNHNLV 583
            :|.|.||..|:|.|:|          :....:||  ..|.||:|...|..||.:   .|..::..
Zfish   278 IVHPKSFTFYYCHGNC----------SSAERITTILGITQCCAPVPESMKSLRFTTTSDGGYSFK 332

  Fly   584 LSVIPNMSVEGCSC 597
            ...:||:..|.|:|
Zfish   333 YETLPNIIPEECNC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 27/96 (28%)
inhaNP_001038669.1 TGF_beta 258..346 CDD:278448 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.