DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and tgfb1b

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_692338.3 Gene:tgfb1b / 563884 ZFINID:ZDB-GENE-091028-1 Length:379 Species:Danio rerio


Alignment Length:412 Identity:81/412 - (19%)
Similarity:161/412 - (39%) Gaps:79/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 EKAKVDSIESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHL 264
            |..|...||:|:..||.:|.|.|.|.:.:     :.:|:|.     .:...:|:|....::|...
Zfish    32 ELIKRKRIEAIRGQILSKLRLPKEPEVEE-----KELIENI-----PAELISVYNSTMELNEEQA 86

  Fly   265 S--INDTYGDHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSH 327
            :  :..|..|....:::            |..:::|.:   ..:..:..:..|..|.:::...:|
Zfish    87 ANPVQHTIEDPTEEEYY------------AKEIHKFTM---MEEKPEKYLVFNITDIKHKLGANH 136

  Fly   328 ISSIYIFPEEIQPHVRHNRKVD----VFRFQIDSSYSD-LSYATLHLYLRGWDWISAHQPGLLEE 387
            :    ::..|.:..::..:..|    :..:|:..:.|. |:...:.|...| .|:|......|::
Zfish   137 V----LYQAEFRLRIKEPKMGDSEQRLELYQVTGNKSRYLNSRFISLQTAG-KWVSFDVTSTLKD 196

  Fly   388 IKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEI 452
            ..:.|.:      .:..::....|..|:.:..||...| :||.:     .:...|.|...:.:..
Zfish   197 WLQMPEE------KQEFQLQLACSCKPESQNTEFLFKI-AGLSR-----NRGDTGLLADQVAKPY 249

  Fly   453 LIKGAETWMKSLVVTTDNTSKNPLTVHIEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLKVNF- 516
            ::                ...:|...|    |..|.||||.....|||....  ||...|.::| 
Zfish   250 IL----------------VMSHPADGH----SPAKSRRKRETDAVCTEKSEG--CCVRSLYIDFR 292

  Fly   517 TSFGWHFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAAL------TTSATPCCSPTKMSSLSLLY 575
            ...||.::..|:.:.|.:|:|.|...:..:..::.:.||      ..||.|||.|..:..|.::|
Zfish   293 KDLGWKWIHEPSGYYANYCTGSCSYVWTSENKYSQVLALYRHHNPGASAQPCCVPQVLDPLPIIY 357

  Fly   576 FDDNHNLVLSVIPNMSVEGCSC 597
            :....:.| ..:.||.|:.|.|
Zfish   358 YVGRQHKV-EQLSNMIVKTCKC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 26/97 (27%)
tgfb1bXP_692338.3 TGFb_propeptide 22..253 CDD:279078 43/278 (15%)
TGF_beta 280..378 CDD:278448 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.