DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and tgfb5

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_021336789.1 Gene:tgfb5 / 559723 ZFINID:ZDB-GENE-130425-3 Length:414 Species:Danio rerio


Alignment Length:460 Identity:91/460 - (19%)
Similarity:152/460 - (33%) Gaps:143/460 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 KVDSIESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSIN 267
            |...||:::..||.:|.::..|: .:....||.:.......|| |:|..:..|..          
Zfish    32 KSKRIEAVRGQILSKLRIRSPPD-PEASPTPQPVPAEVMLLYN-STKELLKERAR---------- 84

  Fly   268 DTYGDHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIY 332
                 |.......|||.......:...||.              :|:.|:...            
Zfish    85 -----HAEAACERESSEEDYYAKEVQRVNM--------------MPLRTDTNS------------ 118

  Fly   333 IFPEEIQPHVRHNRKVDVFRF---QIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRK 394
            |.|....|:.|      :..|   .::.:.|.|..|...::         ..|.......:|.  
Zfish   119 ISPGPQSPYFR------IVGFDVTNVERNSSTLVKAEFRIF---------RAPNPQARATEQR-- 166

  Fly   395 DIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLL------------------ 441
               |.|::.::..:.|:  |..:..:.|...|...|.|::||:...:                  
Zfish   167 ---VEIYQILKSEDVTA--PSQRYIDSRTVEPRAKGAWLSVDVTETVKEWMAFRERNLGLKISVH 226

  Fly   442 ----------GNLGSNMTQEI----------LIKGA------------ETWMKSLVVTTDNTSK- 473
                      .|:..|.::|:          |||..            .|....|::|...|.: 
Zfish   227 CPCCTFVPSTNNIVPNKSEELEARFAGIDDDLIKQTRKPGVTKGQIEFSTKTPHLILTLLPTDRL 291

  Fly   474 -NPLTVHIEIGSQKKHRRKRSVYMD---CTENDHDMRCCRYPLKVNF-TSFGWHFVVAPTSFDAY 533
             :|:         ||.|:|||. .|   ||.||..  ||...|.::| ....|.::..|..:.|.
Zfish   292 DSPI---------KKTRKKRSA-ADTSICTRNDQG--CCLRSLYIDFRRDLNWKWIHEPKGYKAN 344

  Fly   534 FCSGDCKVGYLEQYPHTHLAAL------TTSATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSV 592
            ||:|:|...:.....:..:..|      ..||:|||.|..:..|:::||......| ..:.||.|
Zfish   345 FCAGNCPYLWSADNHYNMILPLYNKMNPEASASPCCVPQDLEPLTIVYFLGRTPRV-EQLSNMVV 408

  Fly   593 EGCSC 597
            ..|.|
Zfish   409 RSCKC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 26/97 (27%)
tgfb5XP_021336789.1 TGFb_propeptide 21..229 CDD:307025 42/261 (16%)
TGF_beta 317..413 CDD:306518 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.