DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and nodal1

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001016321.1 Gene:nodal1 / 549075 XenbaseID:XB-GENE-487169 Length:403 Species:Xenopus tropicalis


Alignment Length:376 Identity:87/376 - (23%)
Similarity:148/376 - (39%) Gaps:103/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 FLIDLNKNQAKKSDIPI----NTNDEEYESIL-----------------------SHISSIYIFP 335
            :::.|.:|....:|..:    ||..:||:::|                       |..|.:.:..
 Frog    56 YMMQLYQNLVMANDTGLARGHNTATKEYDTVLSLFAKRCMESEKRWTLSFDMSAVSKSSELKLAE 120

  Fly   336 EEIQ-PHVR--HNRKVDVFRFQIDSSYSDLSYATLHLYL----------RGWDWISAHQPGLLEE 387
            ..|| ||:.  ||..|||:..:....         :|||          :|..|...:...:|:.
 Frog   121 LRIQLPHIEMSHNVTVDVYHTRDGEE---------NLYLGSFEANPFSTKGSPWKVFNVTRILQH 176

  Fly   388 IKKQP---RKDIVVTIHRAIRVANTTS------------FNPKVKMFEFRHSIPSGLGQWVAVD- 436
            ..|:.   :.:.:.|..||.|.:..:|            :||        |..|  |.::::.: 
 Frog   177 YFKEGQDIKSEYLRTKDRAERGSGMSSAEFLDSPGDSPQYNP--------HHTP--LRRYLSTEG 231

  Fly   437 --------LKSLLGNLGSNMTQEILIKGAETWMKSLVVTTDNTSKNP-LTVHIEIGSQKKHRRKR 492
                    :|..:.::|.    ..|||.||:   |..|..:..|:.| :..|....::|.|....
 Frog   232 VMLVLFTKVKPSVNHIGF----PSLIKTAES---SKYVDMEKASRMPGIRRHRRNKNEKHHLSMG 289

  Fly   493 SVYMDCTENDHDMRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALT 556
            |:.....:|...: |.|..:.|||...|| :::|.|..::||.|.|.|.:...|.:..|:.|.:.
 Frog   290 SIPSRHVDNGKPL-CRRVDMIVNFEDIGWGNWIVYPKKYNAYRCEGACPIPLNETFKPTNHAYMK 353

  Fly   557 TSA---------TPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            :..         .|.|.|.|||.||:||::.: .:||.....|.||.|.||
 Frog   354 SVVKLYQPEKVECPLCVPIKMSPLSMLYYEGD-EVVLRHHQEMIVEECGCS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 33/100 (33%)
nodal1NP_001016321.1 TGFb_propeptide 46..218 CDD:279078 31/170 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..220 5/32 (16%)
TGFB 303..403 CDD:214556 33/100 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.