DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Lefty1

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001102550.1 Gene:Lefty1 / 498299 RGDID:1561867 Length:368 Species:Rattus norvegicus


Alignment Length:98 Identity:26/98 - (26%)
Similarity:42/98 - (42%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 RCCRYPLKVNFTSFGW--HFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALTTSATPCCSPTKM 568
            ||||..:.::.....|  ::::.|..|..|.|.|.|.     |.|.:............|..::|
  Rat   264 RCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCL-----QPPESLTIRWPFLGPRQCVASEM 323

  Fly   569 SSLSLLYF---DDNHNLVLSVIPNMSVEGCSCS 598
            :||.|:..   |......:..:|||.|:.|||:
  Rat   324 TSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSCA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 24/95 (25%)
Lefty1NP_001102550.1 TGFb_propeptide 29..211 CDD:413528
TGF_beta_LEFTY1_2 264..355 CDD:381636 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.