DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and NODAL

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_060525.3 Gene:NODAL / 4838 HGNCID:7865 Length:347 Species:Homo sapiens


Alignment Length:334 Identity:79/334 - (23%)
Similarity:124/334 - (37%) Gaps:85/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SILSHISSIYIFPEEIQPHVRHNRKVDV----------FRFQIDSSYSDLSYATLHLYLRGWDWI 377
            |.|:::.|:|..|......:|..:..||          |.|...|...||::|.|.|.|..    
Human    39 SPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSS---- 99

  Fly   378 SAHQP---GLLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFR-----HSIPSGLGQWV- 433
            ....|   .|..||..||:.|........:.......|...:....|.     ..:...|.:|: 
Human   100 PVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLK 164

  Fly   434 ---AVDLK------------------SLLGNLGSNMTQE--------ILIKGAETWMKSLVVTTD 469
               |::.:                  ::|..|.||::||        :|.:...:|         
Human   165 HPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSW--------- 220

  Fly   470 NTSKNPLTVHIEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLKVNFTSFGW-HFVVAPTSFDAY 533
            ...:..|:  .|.|  |:|||...       .|....|.:...:|:|...|| .:::.|..::||
Human   221 RAQEGQLS--WEWG--KRHRRHHL-------PDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAY 274

  Fly   534 FCSGDC--KVGYLEQYP--HTHLAALTTSATP------CCSPTKMSSLSLLYFDDNHNLVLSVIP 588
            .|.|:|  .||. |.:|  |.::.:|.....|      ||:|.|...||:||. ||..::|....
Human   275 RCEGECPNPVGE-EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYV-DNGRVLLDHHK 337

  Fly   589 NMSVEGCSC 597
            :|.||.|.|
Human   338 DMIVEECGC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 33/101 (33%)
NODALNP_060525.3 TGFb_propeptide 29..166 CDD:279078 28/130 (22%)
TGFB 247..346 CDD:214556 33/100 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.