DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and INHBB

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_002184.2 Gene:INHBB / 3625 HGNCID:6067 Length:407 Species:Homo sapiens


Alignment Length:439 Identity:103/439 - (23%)
Similarity:165/439 - (37%) Gaps:129/439 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 RQLREKAKVDS--IESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMES 258
            |:..|..:||.  :|::|.|||.||.::..||||.  :||:..:....|..:| .|.....|:|.
Human    62 RRPEELGRVDGDFLEAVKRHILSRLQMRGRPNITH--AVPKAAMVTALRKLHA-GKVREDGRVEI 123

  Fly   259 IDESHLSINDTYGDHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYES 323
               .||..:.:.|                 .|....|:|.:                 :..|.:.
Human   124 ---PHLDGHASPG-----------------ADGQERVSEII-----------------SFAETDG 151

  Fly   324 ILSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEI 388
            :.|....:|.|       :.:....::|..|          |:|.|||:...::          :
Human   152 LASSRVRLYFF-------ISNEGNQNLFVVQ----------ASLWLYLKLLPYV----------L 189

  Fly   389 KKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLG------SN 447
            :|..|        |.:||        ||...|..|.     .:|..|:.:..|...|      :.
Human   190 EKGSR--------RKVRV--------KVYFQEQGHG-----DRWNMVEKRVDLKRSGWHTFPLTE 233

  Fly   448 MTQEILIKG-------------AETWMKSLVVTTDNTSKNP-LTVHIEIGSQKKHRRKRSVYMDC 498
            ..|.:..:|             .|..:..:.|.....|..| :.|...:|..:...|||.:..|.
Human   234 AIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDG 298

  Fly   499 TENDHDMRCCRYPLKVNFTSFGWH-FVVAPTSFDAYFCSGDCKVGYLEQYPHT----HLAALTT- 557
            ..|    .|||....::|...||: :::|||.:...:|.|.|. .||...|.:    |.|.:.. 
Human   299 RTN----LCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCP-AYLAGVPGSASSFHTAVVNQY 358

  Fly   558 --------SATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
                    :...||.|||:|::|:|||||.:|:|...:|||.||.|.|:
Human   359 RMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 37/104 (36%)
INHBBNP_002184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..62 103/439 (23%)
TGFb_propeptide 57..278 CDD:279078 58/303 (19%)
TGFB 303..406 CDD:214556 37/103 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.