DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Lefty2

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_796073.1 Gene:Lefty2 / 320202 MGIID:2443573 Length:368 Species:Mus musculus


Alignment Length:376 Identity:70/376 - (18%)
Similarity:127/376 - (33%) Gaps:98/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 MQGDDANTVNEFLIDLNKNQAKKSDIP-INTNDEEYESILSHISSIYI--FPEEIQPHVRHNRKV 348
            :.|..|....|.::.....|.:.|..| :::.|.|..:|.:|:.|.|:  .........|..|..
Mouse    15 LAGPGAAMTEEQVLSSLLQQLQLSQAPTLDSADVEEMAIPTHVRSQYVALLQGSHADRSRGKRFS 79

  Fly   349 DVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTIHRAIRVANTTSFN 413
            ..|| ::...:. :|..:.||.:.|.            |.:..|..::|..:.|..:..     .
Mouse    80 QNFR-EVAGRFL-MSETSTHLLVFGM------------EQRLPPNSELVQAVLRLFQEP-----V 125

  Fly   414 PKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEI---LIKGAETWMKSLVVTTD------ 469
            |:..:..|....|......|.::...:..: |||.|..|   |:...|:..|:..||..      
Mouse   126 PRTALRRFERLSPHSARARVTIEWLRVRED-GSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQ 189

  Fly   470 -NTSKNPLTVHIEI-------GSQKKHRRKRSVYMDCTEND---------HDM------------ 505
             :..:.||.:.:.:       |:...|:..|.......:..         |.:            
Mouse   190 LSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCD 254

  Fly   506 ---------RCCRYPLKVNFTSFGW--HFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALTTSA 559
                     ||||..:.::.....|  ::::.|..|..|.|.|.|.     |.|.:.........
Mouse   255 PEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCL-----QLPESLTIGWPFLG 314

  Fly   560 TPCCSPTKMSSLSLLYFDDNHNLVLSV------------IPNMSVEGCSCS 598
            ...|..::|:||.         :::||            :|||.|:.|||:
Mouse   315 PRQCVASEMTSLP---------MIVSVKEGGRTRPQVVSLPNMRVQTCSCA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 24/104 (23%)
Lefty2NP_796073.1 TGFb_propeptide <106..211 CDD:279078 19/110 (17%)
TGF_beta 263..355 CDD:278448 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.