DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and gdf7

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_694563.2 Gene:gdf7 / 30642 ZFINID:ZDB-GENE-990714-1 Length:422 Species:Danio rerio


Alignment Length:368 Identity:97/368 - (26%)
Similarity:139/368 - (37%) Gaps:100/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 ANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQID 356
            ||||..|: ||.:      |.|.....::|...||.:|.:   .|.::..:|      |.|....
Zfish    92 ANTVTSFM-DLGQ------DEPSLMFQQQYTFNLSGLSRL---DELMEVELR------VLRRPPQ 140

  Fly   357 SSYSDLSYATLHLY--------LRGWDWISAHQPGLLEEIKKQPRKDIVVTIHRAIRVANTTSFN 413
            ...|.|||.. :||        |.|    |.|||.||..              |.|.:.:|:|..
Zfish   141 DVLSLLSYGG-NLYRLLLHTCSLPG----SLHQPLLLSS--------------RTIDLLDTSSAT 186

  Fly   414 PKVKMFEFRHSIPSGLGQW-VAVDLKSLLGNLG--SNMTQEILIKG--------AETWMKSLVVT 467
            ..|  |:....|.:.|.|. .|.|.:.|..::.  |:...|.:..|        .:|..::|:|.
Zfish   187 WDV--FDVGPIIKTPLKQHRTAEDTRLLCLSISAVSDSNNEAVHPGMLGLSREDQQTHERALLVA 249

  Fly   468 TDNTSK---------------------NPLTVHIEIGSQKKHRRKRSVYM-------DCTEND-- 502
            .....:                     ||...| .|....:|||:|...:       ..|...  
Zfish   250 FSQARRKENLFREIREKIRAMKSRKFSNPTPEH-SIKGHPRHRRRRRTALAGRPGVGPITSGGKG 313

  Fly   503 ---HDMRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKV---GYLEQYPHTHLAALTTSAT 560
               ...||.|.||.|||...|| .:::||..::||.|.|.|..   .:||...|..:..|..|..
Zfish   314 GGRRRTRCSRKPLHVNFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLMNSMD 378

  Fly   561 P------CCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            |      ||.|:|:|.:|:||.|..:|:|.....:|.||.|.|
Zfish   379 PESTPPSCCVPSKLSPISILYIDSGNNVVYKQYEDMVVESCGC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 38/100 (38%)
gdf7XP_694563.2 TGFb_propeptide 62..250 CDD:279078 49/194 (25%)
TGFB 324..422 CDD:214556 36/98 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.