DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Gdf1

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001037705.1 Gene:Gdf1 / 306351 RGDID:1304678 Length:357 Species:Rattus norvegicus


Alignment Length:106 Identity:38/106 - (35%)
Similarity:55/106 - (51%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 CCRYPLKVNFTSFGWH-FVVAPTSFDAYFCSGDCKVGYLEQYP-------HTHLAALTTSA---- 559
            |....|.|:|...||| :|:||..|.|.||.|.|.:....:.|       |..|.||..:|    
  Rat   251 CRTRRLHVSFREVGWHRWVIAPRGFLANFCQGTCALPETLRGPGGPPALNHAVLRALMHAAAPTP 315

  Fly   560 ---TPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
               :|||.|.::|.:|:|:||::.|:||....:|.|:.|.|
  Rat   316 GVGSPCCVPERLSPISVLFFDNSDNVVLRHYEDMVVDECGC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 37/104 (36%)
Gdf1NP_001037705.1 TGFB 251..357 CDD:214556 38/106 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.