DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and lft2

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_571036.1 Gene:lft2 / 30146 ZFINID:ZDB-GENE-990630-11 Length:362 Species:Danio rerio


Alignment Length:361 Identity:79/361 - (21%)
Similarity:126/361 - (34%) Gaps:122/361 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 INTNDEEYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWIS 378
            |...|.|...:.:||.|.|:...::. |.|..|                |..:|...|||     
Zfish    41 IQKRDLENLVVPAHIKSKYLSMLKLH-HQRRRR----------------SLPSLAGILRG----- 83

  Fly   379 AH-QPGLLEEIK--KQPRKDIVVTIHRAIRVANTTSFNPKVKMF----------EFRHSIPSGLG 430
            .| ...:..|||  ...|:.:|..:...:: .||.....::|:|          |.||..|....
Zfish    84 IHGNADITGEIKYSDTTRQRLVFDMEARLQ-ENTEVTMAELKLFQTAAQSPSKPERRHHRPINHA 147

  Fly   431 Q----WVAVDLKSLLGNLGSNMTQEI---LIKGAETWMKSLVVT------TDNTSKNPLTVHIEI 482
            :    ||.|     |.| |||.|..:   |:...|:..:|..||      :.:..|.||  |:|:
Zfish   148 RVSIYWVEV-----LEN-GSNRTSLLDSRLVPIHESGWRSFDVTQAIHYWSKSQKKAPL--HLEV 204

  Fly   483 -------GSQKKHRRKRSVYM--------------------------------DCTENDHDMRCC 508
                   ||......||..:.                                :|..:.:..:||
Zfish   205 WTEGERPGSYAAEMAKRVRFATQDPKENTLEKDMGAPELVLYTLDLDEYGSQGNCNSSPNSSKCC 269

  Fly   509 RYPLKVNFTSFGW--HFVVAPTSFDAYFCSGDCK------VGYLEQYPHTHLAALTTSATPCCSP 565
            |....:||....|  ::::.|..:.|:.|:|.||      .||.::               .|:.
Zfish   270 REEHFINFRELTWTQYWIIEPAGYQAFRCAGGCKQPKRGFYGYGQR---------------TCAV 319

  Fly   566 TKMSSLSLLYF---DDNHNLVLSVIPNMSVEGCSCS 598
            .:.:.|.::|.   .|...:.::..|||.||.|.||
Zfish   320 MESAPLPMMYLVKKGDYTEIEVAEFPNMIVEKCGCS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 24/101 (24%)
lft2NP_571036.1 TGFb_propeptide 15..204 CDD:366248 47/193 (24%)
TGF_beta_LEFTY1_2 267..354 CDD:381636 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.