DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Nodal

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001099864.1 Gene:Nodal / 294503 RGDID:1305994 Length:354 Species:Rattus norvegicus


Alignment Length:359 Identity:79/359 - (22%)
Similarity:134/359 - (37%) Gaps:86/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 LNKNQAKKSDIPINTNDE-EYESILSHISSIYIFPEEIQPHVRHNRKVDV----------FRFQI 355
            |:...|..:.:|:.|..: ...|.|:::.|:|..|......:|..:..||          |.|..
  Rat    18 LHPRVATAAALPLWTRGQPSSPSPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSF 82

  Fly   356 DSSYSDLSYATLHLYLRGWDWISAHQP-------GLLEEIKKQPRKDIVVTIHRA--IRVANTTS 411
            .|...||.:|.|.|.|..    ....|       .:..:.|..|.:|....:.|.  .|:..|.|
  Rat    83 LSQEEDLVWAELRLQLLS----PMDSPTKGPLTIDIFHQAKPDPEQDPADCLERVWMERITVTPS 143

  Fly   412 ---FNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEILIKGAETWMKSLVVTTDNTSK 473
               |.....:.|    :...|.:|:. |.::|        .:::..:..:.|.:|.......||.
  Rat   144 QVTFASDSTVLE----VTKPLSKWLK-DPRAL--------EKQVSSQAGKCWHQSHTQPVPVTST 195

  Fly   474 NPLTVHIEIGSQKKH-----------------------------RRKRSVYMDCTENDHDMRCCR 509
            :.|.::.....:::.                             ||:|..::.    |....|.|
  Rat   196 SVLMLYSNRPQEQRQLGGATLLWEAESSWRAQEGQLSVERSGWGRRQRRHHLP----DRSQLCRR 256

  Fly   510 YPLKVNFTSFGW-HFVVAPTSFDAYFCSGDC--KVGYLEQYP--HTHLAALTTSATP------CC 563
            ...:|:|...|| .:::.|..::||.|.|:|  .||. |.:|  |.::.:|.....|      ||
  Rat   257 VKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGE-EFHPTNHAYIQSLLKRYQPHRVPSTCC 320

  Fly   564 SPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            :|.|...||:||. ||..::|....:|.||.|.|
  Rat   321 APVKTKPLSMLYV-DNGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 34/101 (34%)
NodalNP_001099864.1 TGFb_propeptide 33..169 CDD:279078 30/144 (21%)
TGFB 254..353 CDD:214556 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.