DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Inhba

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_058824.1 Gene:Inhba / 29200 RGDID:62074 Length:424 Species:Rattus norvegicus


Alignment Length:445 Identity:94/445 - (21%)
Similarity:168/445 - (37%) Gaps:124/445 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DSIESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDT 269
            :.:|::|.|||..|:|||.|::|:|  ||:..:.|..|..:.....         :..::.|.|.
  Rat    53 EMVEAVKKHILNMLHLKKRPDVTQP--VPKAALLNAIRKLHVGKVG---------ENGYVEIEDD 106

  Fly   270 YGDHIMTDFFDESSSSQMQGDDANTVNEFL-IDLNKNQAKKSDIPINTNDEEYESILSHISSIYI 333
            .|.....:...|.:|..:...::.|..:.| .:::|   :.||:.:....|           :::
  Rat   107 IGRRAEMNELMEQTSEIITFAESGTARKTLHFEISK---EGSDLSVVERAE-----------VWL 157

  Fly   334 FPEEIQPHVRHNR-KVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLL------EEIKKQ 391
            |.:  .|.....| ||.:..||...                      |..|.|      ||:..:
  Rat   158 FLK--VPKANRTRTKVTIRLFQQQK----------------------HPQGSLDMGDEAEEMGLK 198

  Fly   392 PRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEILIKG 456
            ..:..::...:.:....:|           .|..|      |:..::.||....|::...|..:.
  Rat   199 GERSELLLSEKVVDARKST-----------WHIFP------VSSSIQRLLDQGKSSLDVRIACEQ 246

  Fly   457 AETWMKSLV---------VTTDNTSKNPLTVHIEIGSQKKHR---------------RKRSVYMD 497
            .:....|||         |..|...|:.....:|...::.||               |:|...::
  Rat   247 CQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKEQSHRPFLMLQARQSEDHPHRRRRRGLE 311

  Fly   498 CTENDHDMR-CCRYPLKVNFTSFGWH-FVVAPTSFDAYFCSGDCK-----------------VGY 543
            |   |..:. ||:....|:|...||: :::||:.:.|.:|.|:|.                 :.:
  Rat   312 C---DGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINH 373

  Fly   544 LEQYPHTHLAALTTSATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            .....|:..|.|.:    ||.|||:..:|:||:||..|::...|.||.||.|.||
  Rat   374 YRMRGHSPFANLKS----CCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 32/109 (29%)
InhbaNP_058824.1 TGFb_propeptide 56..236 CDD:413528 45/245 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..306 7/41 (17%)
TGF_beta_INHBA 317..424 CDD:381674 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.