DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and AMH

DIOPT Version :10

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_000470.3 Gene:AMH / 268 HGNCID:464 Length:560 Species:Homo sapiens


Alignment Length:88 Identity:21/88 - (23%)
Similarity:33/88 - (37%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 VVAPTSFDAYFCSGDCKVGYLEQYPH--THLAAL--------TTSATPCCSPTKMSSLSLLYFDD 578
            |:.|.::.|..|.|.|.....::.|.  .|:..|        ..:..|||.||..:...|:...:
Human   477 VLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSE 541

  Fly   579 N----HNLVLSVIPNMSVEGCSC 597
            .    |:     :|||....|.|
Human   542 ERISAHH-----VPNMVATECGC 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta_GDF8_like 506..597 CDD:381629 20/86 (23%)
AMHNP_000470.3 AMH_N 77..398 CDD:461402
TGF_beta_AMH 461..560 CDD:381635 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.