DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and tig-3

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_497318.2 Gene:tig-3 / 266879 WormBaseID:WBGene00021594 Length:251 Species:Caenorhabditis elegans


Alignment Length:323 Identity:60/323 - (18%)
Similarity:110/323 - (34%) Gaps:106/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 AKKSDIPINTNDEEYESILSHISSIYIFPEEIQPHVRHNRK-----------VDVFRFQIDSSYS 360
            ::|.|:        |..:|..|:        ::|    |||           .|.|::.|:|...
 Worm     4 SRKHDL--------YGGVLDKIT--------LEP----NRKSWTCLTPESLVKDCFQYSINSINH 48

  Fly   361 DLSYATLHLYLRGWDWISAHQPGLLEEIKKQPR-KDIVVTIHRAIRVANTTSFNPKVKMFEFRHS 424
            ::..|:|.:                     .|: .:|.:.::....:.....:   |..||.|.:
 Worm    49 EILSASLII---------------------DPKDTNISIVVYEVDELFGELQY---VDRFEIRET 89

  Fly   425 IPSGLGQWVAVDLKSLLGNLGSNMTQEILIKGAETWMKSLVVTTDNTSK--NPLTV--------- 478
            :..     ...|:..|........:.:.:||        :.:|..||..  |.|:|         
 Worm    90 LDK-----YHFDISHLFHKWMKQKSSDKMIK--------IEITNSNTQNVINALSVLRNAPNFDV 141

  Fly   479 ------HIEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLKVNFTSFGWH-FVVAPTSFDAYFCS 536
                  .:..|:.           ||      :.||..|..||||..||: ::::|..|.|..||
 Worm   142 MVFQPNTVTAGTS-----------DC------VGCCVIPFYVNFTEIGWNDWILSPPGFYANVCS 189

  Fly   537 GD-CKVGYLEQYPHTHLAALTTSATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            .. |.....|.|.... ||::....|.|:|....|:.::......::..:.:..:....|||:
 Worm   190 DTVCSTESDEVYQFMK-AAISDLPEPKCAPNYYGSVDMIVALSPRDIRKTRVHGLRALSCSCT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 24/92 (26%)
tig-3NP_497318.2 TGF_beta_INHB 159..250 CDD:381630 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.