DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and MSTN

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_005250.1 Gene:MSTN / 2660 HGNCID:4223 Length:375 Species:Homo sapiens


Alignment Length:420 Identity:118/420 - (28%)
Similarity:183/420 - (43%) Gaps:109/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 REKAKVDSIESIKMHILMRLNLKKLPNITK-------PISVP-QNIIDNFYRDYNASSKTTVWNR 255
            |:..|...||:||:.||.:|.|:..|||:|       |.:.| :.:||.:               
Human    45 RQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQY--------------- 94

  Fly   256 MESIDESHLSINDTYGDHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEE 320
                |...                |:||...::.||.:...|.:|.:    ..:||         
Human    95 ----DVQR----------------DDSSDGSLEDDDYHATTETIITM----PTESD--------- 126

  Fly   321 YESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLL 385
                       ::...:.:|      |...|:|.....|:.:..|.|.:|||..:..:.....:|
Human   127 -----------FLMQVDGKP------KCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQIL 174

  Fly   386 EEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLL--------G 442
            ..||  |.||  .|.:..|| :.....||             |.|.|.::|:|::|        .
Human   175 RLIK--PMKD--GTRYTGIR-SLKLDMNP-------------GTGIWQSIDVKTVLQNWLKQPES 221

  Fly   443 NLGSNMTQEILIKGAETWMKSLVVTTDNTSKNPLTVHIEIG-SQKKHRRKRSVYMDCTENDHDMR 506
            |||      |.||..:.....|.||.....::.|...:|:. :....|.:|...:||.|:..:.|
Human   222 NLG------IEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR 280

  Fly   507 CCRYPLKVNFTSFGWHFVVAPTSFDAYFCSGDCKVGYLEQYPHTHL---AALTTSATPCCSPTKM 568
            ||||||.|:|.:|||.:::||..:.|.:|||:|:..:|::||||||   |....||.|||:||||
Human   281 CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKM 345

  Fly   569 SSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
            |.:::|||:....::...||.|.|:.|.||
Human   346 SPINMLYFNGKEQIIYGKIPAMVVDRCGCS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 45/93 (48%)
MSTNNP_005250.1 TGFb_propeptide 39..249 CDD:279078 64/292 (22%)
TGFB 281..375 CDD:214556 44/93 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6128
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3850
Inparanoid 1 1.050 159 1.000 Inparanoid score I4266
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001977
OrthoInspector 1 1.000 - - otm41502
orthoMCL 1 0.900 - - OOG6_105895
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2472
SonicParanoid 1 1.000 - - X1292
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.