DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Bmp3

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_058801.1 Gene:Bmp3 / 25667 RGDID:2212 Length:468 Species:Rattus norvegicus


Alignment Length:490 Identity:121/490 - (24%)
Similarity:185/490 - (37%) Gaps:118/490 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PGKKSTPLAKVSEH--------GDLSRVQSVSLYRNTLINIESMLQRQLREKAKVDSIESIKMHI 214
            |.....|..|||||        ...:|.|:.....:.|..     .:.||....|.|..:.....
  Rat    46 PSPDLRPHDKVSEHMLWLYDRYSGSNRAQATRTPGSQLPG-----PQPLRGGNTVRSFRAAAAGT 105

  Fly   215 LMR--LNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDTYGDHIMTD 277
            |.|  |:...|.::||    .:||:......|......|..|..||...||    |:...||..|
  Rat   106 LQRKGLHTFNLTSLTK----SENILSATLYFYIGELVNTSVNCPESQGCSH----DSQRQHIQID 162

  Fly   278 FFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPEEIQPHV 342
            .    |:..:|.:.:..:....:|..|               .|...:|.:|      ::|...:
  Rat   163 L----SAWTLQSNQSQLLGHLSVDTAK---------------PYRDSMSWLS------KDITQLL 202

  Fly   343 RHNRKVDVF--RFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTI--HRA 403
            |..::.:.|  .|.|.|...:|....| |:...:..:.|:...:.|.      :.:|.::  ||.
  Rat   203 RKAKQDEEFLIGFNITSRAHELPKRML-LFPEPYILVYANDAAICEP------ESVVSSLQRHRD 260

  Fly   404 IRVANTTSFNPKVK---MFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEILIKGAETW----- 460
            .........:..|:   ..|.|....:|:  .:.:....|.|       .|...|.|..|     
  Rat   261 FTAGTVPRLDSHVREALSVERRKKRSTGI--LLPLQNNELPG-------AEYQYKEAGVWEERKP 316

  Fly   461 MKSLVVTTDNTS-------KNP----LTVHIEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLKV 514
            .|||.......|       |.|    .|:..:..:.||.|||:.:        ....|.|..|||
  Rat   317 YKSLQTQPPEKSRSKKKQRKGPHQKGQTLQFDEQTLKKARRKQWI--------EPRNCARRYLKV 373

  Fly   515 NFTSFGW-HFVVAPTSFDAYFCSGDCKVGYLEQYP---------HTHLAALTTSA-------TPC 562
            :|...|| .::::|.|||||:|||.|      |:|         |..:.::..:.       .||
  Rat   374 DFADIGWSEWIISPKSFDAYYCSGAC------QFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPC 432

  Fly   563 CSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            |.|.||||||:|:||:|.|:||.|.|||:|:.|:|
  Rat   433 CVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCAC 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 44/107 (41%)
Bmp3NP_058801.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53 1/6 (17%)
TGFb_propeptide 46..>203 CDD:279078 41/194 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..93 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..349 7/32 (22%)
TGF_beta 364..467 CDD:278448 44/108 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.