DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Bmp6

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_038951315.1 Gene:Bmp6 / 25644 RGDID:2214 Length:535 Species:Rattus norvegicus


Alignment Length:531 Identity:100/531 - (18%)
Similarity:178/531 - (33%) Gaps:187/531 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LQRQLREKAKVDSIESIKMHILMRLNLKKLPNITKPISVPQNII--------------------- 237
            |.|:|:...|    ..::..||..|.|...|.....:..||:.:                     
  Rat    64 LYRRLKTHEK----REMQKEILSVLGLPHRPRPLHGLQQPQSPVLPQQQQSQQTAREEPPPGRLK 124

  Fly   238 --DNFYRD-YNASSKTTVWNRMESIDESHLSINDTYGDHIMTDFFDESSSSQMQGDDANTVNEFL 299
              ..|..| ||:.||          |:....:::  |:.:..:....:||||::.......:   
  Rat   125 SAPLFMLDLYNSLSK----------DDEEDGVSE--GEGLEPESHGRASSSQLKQPSPGAAH--- 174

  Fly   300 IDLNKNQAKK-----SDIPINTNDE-----EYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQ 354
             .||:.....     |..|:.:..:     :.:.::|.::.:. :.:|..|..||:::   |:|.
  Rat   175 -SLNRKSLLAPGPGGSASPLTSAQDSAFLNDADMVMSFVNLVE-YDKEFSPRQRHHKE---FKFN 234

  Fly   355 IDS-------------SYSDLSYATL--HLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTIHRAI 404
            :..             .|.|....:.  ..:|     ||.:|  :|:|  .|.|...:..:...:
  Rat   235 LSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFL-----ISIYQ--VLQE--HQHRDSDLFLLDTRV 290

  Fly   405 RVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEILIKGAETWMKSLVVTTD 469
            ..|:...:      .||..:..|.|  ||.....    |:|..::               |||.|
  Rat   291 VWASEEGW------LEFDITATSNL--WVVTPQH----NMGLQLS---------------VVTRD 328

  Fly   470 NTSKNPLT------------------------VHIEIGSQKKHRRKR---------------SVY 495
            ....||..                        ||:........||::               |..
  Rat   329 GLHINPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSSA 393

  Fly   496 MDCTENDHDMRCCRYPLKVNFTSFGWH-FVVAPTSFDAYFCSGDCKV---GYLEQYPHTHLAALT 556
            .|...::....|.::.|.|:|...||. :::||..:.|.:|.|:|..   .::....|..:..|.
  Rat   394 SDYNSSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLV 458

  Fly   557 TSAT-----------------------------------PCCSPTKMSSLSLLYFDDNHNLVLSV 586
            ::.|                                   |||:|||::::|:||||||.|::|..
  Rat   459 SALTWLVGPGLDPVSFLTVSSHASLLEQVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKK 523

  Fly   587 IPNMSVEGCSC 597
            ..||.|..|.|
  Rat   524 YRNMVVRACGC 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 34/129 (26%)
Bmp6XP_038951315.1 TGFb_propeptide 58..355 CDD:395559 59/350 (17%)
TGF_beta_BMP6 404..535 CDD:381666 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.