DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Gdf6

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001013056.1 Gene:Gdf6 / 252834 RGDID:620104 Length:452 Species:Rattus norvegicus


Alignment Length:513 Identity:114/513 - (22%)
Similarity:175/513 - (34%) Gaps:168/513 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 DLSRVQSVSLYRNTLINIESMLQRQLREKAKV-----DSIE--SIKMH------ILMRL---NLK 221
            ||...|..|:..::...::|....:.|:..|:     :|.|  :.|.|      :..||   :|.
  Rat    19 DLPGFQQASISSSSSTELDSTKDVENRKGGKMQRTPQESAEGRTPKEHRPRPNELRRRLPGQSLG 83

  Fly   222 KLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDTYGDHIMTDFFDESSSSQ 286
            :.|....|..||...:.:.||.|:.:.|              |.||        ..||..|.|  
  Rat    84 QEPPGRGPRVVPHEYMLSIYRTYSIAEK--------------LGIN--------ASFFQSSKS-- 124

  Fly   287 MQGDDANTVNEF----LIDLNKNQAKKS----DIPINTNDEEYESILSHISSIYIF----PEEIQ 339
                 |||:..|    |.||:....::.    |:...::.||...     :.:.::    |....
  Rat   125 -----ANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVG-----AELRLYRQAPPTPWG 179

  Fly   340 PHVRHNRKVDVFRFQIDSSYSDLSYATLHLYL---------------------RGWDWISAHQPG 383
            |..|                      .|||.|                     .||:.....|  
  Rat   180 PQTR----------------------PLHLQLFPCLSPLLLDSRTLDPQGPTEAGWEVFDVWQ-- 220

  Fly   384 LLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNM 448
               .::.||.|.:.:.:.......:......:          |.|..|...:||:||........
  Rat   221 ---VLRPQPWKQLCLELRAVWGELDARDSGAR----------PRGPQQSPPLDLRSLGFGRRVRP 272

  Fly   449 TQEILIKGAETWMKSLVVTTDNTSKNPLT-VHIEIGSQKK------------------------H 488
            .||..:         |||.|.:..||..| :|.::||.:.                        .
  Rat   273 PQERAL---------LVVFTRSQRKNLFTEMHEQLGSAEAAGAEGSWPAPSGAPDAGSWLPSPGR 328

  Fly   489 RRKRSVYMDCTENDHD----MRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKV---GYLE 545
            ||:|:.........|.    :||.|.||.|||...|| .:::||..::||.|.|.|..   .:||
  Rat   329 RRRRTALSSRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLE 393

  Fly   546 QYPHTHLAALTTSATP------CCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            ...|..:..|..|..|      ||.|||::.:|:||.|..:|:|.....:|.||.|.|
  Rat   394 PTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 38/100 (38%)
Gdf6NP_001013056.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..93 12/63 (19%)
TGFb_propeptide 66..282 CDD:279078 53/295 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..267 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..348 4/46 (9%)
TGF_beta 350..451 CDD:278448 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.