DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Gdf15

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001317616.1 Gene:Gdf15 / 23886 MGIID:1346047 Length:303 Species:Mus musculus


Alignment Length:109 Identity:24/109 - (22%)
Similarity:43/109 - (39%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 RCCRY-PLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKVGYLEQYPHTHLAALTTS---------- 558
            |||.. .::......|| .:|::|.......|.|:|        ||.:.:|.|.:          
Mouse   204 RCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGEC--------PHLYRSANTHAQIKARLHGLQ 260

  Fly   559 ----ATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSCS 598
                ..|||.|:..:.:.|::..|: .:.|....::...||.|:
Mouse   261 PDKVPAPCCVPSSYTPVVLMHRTDS-GVSLQTYDDLVARGCHCA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 23/106 (22%)
Gdf15NP_001317616.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.