DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Nodal

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_038639.2 Gene:Nodal / 18119 MGIID:97359 Length:354 Species:Mus musculus


Alignment Length:335 Identity:73/335 - (21%)
Similarity:123/335 - (36%) Gaps:81/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SILSHISSIYIFPEEIQPHVRHNRKVDV----------FRFQIDSSYSDLSYATLHLYLRGWDWI 377
            |.|:::.|:|..|......:|..:..||          |.|...|...||.:|.|.|.|.|...|
Mouse    40 SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDI 104

  Fly   378 SAHQP---GLLEEIKKQPRKDIVVTIHRA-----IRVANTTSFNPKVKMFEFRHSIPSGLGQWVA 434
            ....|   .:..:.|..|.:|....:.|.     ..:.:..:|.....:.|    :...|.:|:.
Mouse   105 PTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLE----VTKPLSKWLK 165

  Fly   435 VDLKSLLGNLGSNMTQEILIKGAETWMKSLVVTTDNTSKNPLTVH-------------------- 479
             |.::|        .:::..:..:.|.:.........|.|.|.::                    
Mouse   166 -DPRAL--------EKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSNRPQEQRQLGGATLLWEAE 221

  Fly   480 -----------IEIGSQKKHRRKRSVYMDCTENDHDMRCCRYPLKVNFTSFGW-HFVVAPTSFDA 532
                       :|.|...:.:|:..:      .|....|.|...:|:|...|| .:::.|..::|
Mouse   222 SSWRAQEGQLSVERGGWGRRQRRHHL------PDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNA 280

  Fly   533 YFCSGDC--KVGYLEQYP--HTHLAALTTSATP------CCSPTKMSSLSLLYFDDNHNLVLSVI 587
            |.|.|:|  .||. |.:|  |.::.:|.....|      ||:|.|...||:||. ||..::|...
Mouse   281 YRCEGECPNPVGE-EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYV-DNGRVLLEHH 343

  Fly   588 PNMSVEGCSC 597
            .:|.||.|.|
Mouse   344 KDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 34/101 (34%)
NodalNP_038639.2 TGFb_propeptide 33..169 CDD:279078 29/133 (22%)
TGFB 254..353 CDD:214556 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.