DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and unc-129

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_501566.1 Gene:unc-129 / 177719 WormBaseID:WBGene00006852 Length:407 Species:Caenorhabditis elegans


Alignment Length:400 Identity:82/400 - (20%)
Similarity:144/400 - (36%) Gaps:108/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 DANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIY-IFPEE-----------IQPHVR 343
            |.:.:||.:.||  ...|.||..:.:......::..|:.::| .|.:|           |:|.|.
 Worm    22 DVDLINETIRDL--LHFKSSDPNVTSFHRSSHTLTEHMKNLYENFIDEDSNEDGNLVRAIEPAVG 84

  Fly   344 HNRKVDVFRFQID--SSYSDLSYATLHLYLRGWD--------WISAHQPGLLEEIKKQPRKDIVV 398
            .....:|..|.::  .|:..:..|.||.|||..|        .|.|....:.|..::|..|.|.|
 Worm    85 KFEGQEVLVFDVEGFDSHESIMRAELHFYLRRRDSFARRRSRQIRAKSVCVNEYCRQQTLKKIRV 149

  Fly   399 ------TIHRAIRVANTT---SFNPKVKMFEFR----HSIPSGLGQWV---------------AV 435
                  ..::.|..|..:   |::...|...||    ||......:.:               .:
 Worm   150 GGDENLEEYKVIWDATKSVFDSYHLDAKQAVFRITREHSKMRPYAEMIRKSTPFLVIYSKVNHTL 214

  Fly   436 DLKSLLGNLGSNMTQEILIKGAETWMKSL-------VVTTDNTSKNPLTVHIEIGSQKKHRRKRS 493
            |..|::     ..|::...|..:...:.|       .:..||..:.|:        ::|:.:|.|
 Worm   215 DTVSVM-----KQTEQTKRKRRDLGNEELREYYNYNSIPLDNDDREPI--------KRKNGKKNS 266

  Fly   494 VYMDCTEND-----------------------HDM---------RCCRYPLKVNFTSFGW-HFVV 525
            :..:.:..|                       :|:         ||.:..:.|:...||| .:|:
 Worm   267 LSEEISSEDVWQGFGEETSREERERIANEELANDVRVVLLQNKNRCHKEGVLVSLKHFGWDRYVI 331

  Fly   526 APTSFDAYFCSGDCKVGYL---EQYPHTHLAALTTSATPCCSPTKMSSLSLLYFDDNHNLVLSVI 587
            .|.:.:..||.|.|....|   :...|..|.:|..:...||:||.:.||:..|.|:....|:...
 Worm   332 EPKTIETSFCKGKCAKPMLTSGKASNHAMLQSLFAAEPVCCAPTNLKSLNFWYRDEKGRTVIRNY 396

  Fly   588 PNMSVEGCSC 597
            ..|.:..|||
 Worm   397 SKMLIGSCSC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 27/94 (29%)
unc-129NP_501566.1 TGFB 312..406 CDD:214556 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.