DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Gdf9

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_032136.2 Gene:Gdf9 / 14566 MGIID:95692 Length:441 Species:Mus musculus


Alignment Length:266 Identity:51/266 - (19%)
Similarity:96/266 - (36%) Gaps:73/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 WISAHQPGLLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQWVAVDLKSL 440
            ||......||:.:.....:    :||.::....|....|:..:|....|:|           .||
Mouse   204 WIEIDVTSLLQPLVTSSER----SIHLSVNFTCTKDQVPEDGVFSMPLSVP-----------PSL 253

  Fly   441 LGNLGSNMTQEILIKGAETWMKSLVVT--------TDNTSKNPL---TVHIEIGSQKKHRRKRSV 494
            :..|....||     ...:| :||..|        ....:..|:   .:.:| .|.::.|.::::
Mouse   254 ILYLNDTSTQ-----AYHSW-QSLQSTWRPLQHPGQAGVAARPVKEEAIEVE-RSPRRRRGQKAI 311

  Fly   495 YMDC--------------------TEND---HDMRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFC 535
            ..:.                    .:|:   ||.|       ::|:...| :::|||..::..:|
Mouse   312 RSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFR-------LSFSQLKWDNWIVAPHRYNPRYC 369

  Fly   536 SGDCKVGYLEQY---PHTHLAAL------TTSATPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMS 591
            .|||......:|   .||.:..:      .:...|.|.|.|.|.||:|..:.:.::......:|.
Mouse   370 KGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMI 434

  Fly   592 VEGCSC 597
            ...|:|
Mouse   435 ATRCTC 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 23/100 (23%)
Gdf9NP_032136.2 TGF_beta_GDF9 336..441 CDD:381673 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.