DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Bmp8a

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001242948.1 Gene:Bmp8a / 12163 MGIID:104515 Length:412 Species:Mus musculus


Alignment Length:468 Identity:106/468 - (22%)
Similarity:167/468 - (35%) Gaps:153/468 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QRQLREKAKVDSIESIKMHILMRLNLKKLPN-------ITKPISVPQNIIDNFYRDYNASSKTTV 252
            ||:|..:.:.|    ::..||..|.|...|.       ..:|.|.|..::|             :
Mouse    32 QRRLGARERRD----MQREILAVLGLPGRPRPRAQPAAARQPASAPLFMLD-------------L 79

  Fly   253 WNRMESID-----ESHLSIND-------------TYG---DHIMTDFFDESSSSQMQGDDANTVN 296
            ::.|...|     ::||...|             |.|   .|.....||   .:|:...:|.|..
Mouse    80 YHAMTDDDDGGPPQAHLGRADLVMSFVNMVERDRTLGYQEPHWKEFHFD---LTQIPAGEAVTAA 141

  Fly   297 EFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSD 361
            ||.|     ..:.|..|:||.        .|||..    |.:|.|  .||:.|:|       :.|
Mouse   142 EFRI-----YKEPSTHPLNTT--------LHISMF----EVVQEH--SNRESDLF-------FLD 180

  Fly   362 LSYATLHLYLRGW---DWISAHQPGLLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRH 423
            |.  ||.....||   |..:|....||..     .||:.:.::  :..|:..|.:|         
Mouse   181 LQ--TLRSGDEGWLVLDITAASDRWLLNH-----HKDLGLRLY--VETADGHSMDP--------- 227

  Fly   424 SIPSGLGQWVAVDLKSLLGNLGSNMTQEILIKGAETWMKSLVVTTDNTSKNPLTVHIEIGSQKKH 488
                        .|..|||.......|..:            ||....|::|:.........|:.
Mouse   228 ------------GLAGLLGRQAPRSRQPFM------------VTFFRASQSPVRAPRAARPLKRR 268

  Fly   489 RRKRSVYM-------DCTENDHDMR----CCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDC-- 539
            :.|::..:       ...::.|..|    |.|:.|.|:|...|| .:|:||..:.||:|.|:|  
Mouse   269 QPKKTNELPHPNKLPGIFDDGHGSRGREVCRRHELYVSFRDLGWLDWVIAPQGYSAYYCEGECAF 333

  Fly   540 --------------------KVGYLEQYPHTHLAALTTSATPCCSPTKMSSLSLLYFDDNHNLVL 584
                                .|...:::...||.........||:|||:|:.|:||:|.::|::|
Mouse   334 PLDSCMNATNHAILQSLVSTTVACCDRWSGVHLMKPDVVPKACCAPTKLSATSVLYYDSSNNVIL 398

  Fly   585 SVIPNMSVEGCSC 597
            ....||.|:.|.|
Mouse   399 RKHRNMVVKACGC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 35/117 (30%)
Bmp8aNP_001242948.1 TGFb_propeptide 32..248 CDD:279078 64/303 (21%)
TGF_beta 298..411 CDD:278448 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.