DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Bmp15

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_033887.1 Gene:Bmp15 / 12155 MGIID:1316745 Length:392 Species:Mus musculus


Alignment Length:344 Identity:71/344 - (20%)
Similarity:111/344 - (32%) Gaps:125/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DIPINTNDEEYESILSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWD 375
            |.|:.:|...||.|                     |...|:|.|       |.....||......
Mouse   116 DFPLASNQVAYELI---------------------RATVVYRHQ-------LHLVNYHLSCHVET 152

  Fly   376 WI----SAHQPGLLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKVKMFEFRHSIPSGLGQ-WVAV 435
            |:    :.|.|                         ::.|.:.|          ||.:.: |..:
Mouse   153 WVPKCRTKHLP-------------------------SSKSGSSK----------PSPMSKAWTEI 182

  Fly   436 DL-----KSLLGNLGSN------MTQEILIKGAET----W--MKSLVVT--------TDNTSKNP 475
            |:     :.|....|.:      |.|:  .||.||    |  |.||.|.        ||:..:..
Mouse   183 DITHCIQQKLWNRKGRSVLRLRFMCQQ--QKGNETREFRWHGMTSLDVAFLLLYFNDTDDRVQGK 245

  Fly   476 LTVHIEIGSQKKHRRKRSVYM-------------DCTENDHD----MRCCRYPLKVNFTSFGW-H 522
            |...   |.::...|:.|..|             .|...:||    .:|..:|.||:|...|| |
Mouse   246 LLAR---GQEELTDRESSFLMRSVRQACSIESDASCPSQEHDGSVNNQCSLHPYKVSFHQLGWDH 307

  Fly   523 FVVAPTSFDAYFCSGDCK--VGY-LEQYPHTHLAALTTSAT------PCCSPTKMSSLSLLYFDD 578
            :::||..:...:|.|.|.  :.| |....|..:.:|.....      |.|.|.....:|:|..:.
Mouse   308 WIIAPRLYTPNYCKGICTRVLPYGLNSPNHAIIQSLVNELVNHSVPQPSCVPYNFLPMSILLIET 372

  Fly   579 NHNLVLSVIPNMSVEGCSC 597
            |.:::......|..:.|:|
Mouse   373 NGSILYKEYEGMIAQSCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 25/100 (25%)
Bmp15NP_033887.1 TGF_beta 289..391 CDD:278448 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.