DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and Bmp10

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_033886.2 Gene:Bmp10 / 12154 MGIID:1338820 Length:421 Species:Mus musculus


Alignment Length:425 Identity:85/425 - (20%)
Similarity:135/425 - (31%) Gaps:147/425 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 FFDESSSSQMQGDDANTV-----NEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPEE 337
            |||:..:.| .|.|.||:     ||||..||     .||||:.....             :.|.|
Mouse    38 FFDDIFTEQ-DGIDFNTLLQSMKNEFLKTLN-----LSDIPVQDTGR-------------VDPPE 83

  Fly   338 IQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRK-DIVVTIH 401
            ....:.:....|  |..:.|:....|:....|:         .||.....::|.|.. ::.:..|
Mouse    84 YMLELYNKFATD--RTSMPSANIIRSFKNEDLF---------SQPVTFNGLRKYPLLFNVSIPHH 137

  Fly   402 RAIRVANTTSF-------------NPKVKMFEFRHSIPSGLGQWVAVDLKSLLGNL-----GSNM 448
            ..:.:|....:             :.|:.:||...|...      :.:.:|:|..:     |:|.
Mouse   138 EEVVMAELRLYTLVQRDRMMYDGVDRKITIFEVLESADG------SEEERSMLVLVSTEIYGTNS 196

  Fly   449 TQEI--LIKGAETWMKSLVVTTDNTSKNPLTVHIE-----------------IGSQKKHRRKRSV 494
            ..|.  :......|.||      ..|.:.|.:|||                 :.:|.||.....|
Mouse   197 EWETFDVTDATRRWQKS------GPSTHQLEIHIESRQNQAEDTGRGQLEIDMSAQNKHDPLLVV 255

  Fly   495 YMDCTENDHDMR----------------------------------------------------C 507
            :.|...||.:.:                                                    |
Mouse   256 FSDDQSNDKEQKEELNELITHEQDLDLDSDAFFSGPDEEALLQMRSNMIDDSSARIRRNAKGNYC 320

  Fly   508 CRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKVGYLEQYPHT---------HLAALTTSATPC 562
            .:.||.::|...|| .:::||..::||.|.|.|.....|....|         ||.....::..|
Mouse   321 KKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKAC 385

  Fly   563 CSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            |.|||:..:|:||.|............|:|..|.|
Mouse   386 CVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 29/152 (19%)
Bmp10NP_033886.2 TGFb_propeptide 55..256 CDD:279078 43/241 (18%)
TGF_beta 318..420 CDD:278448 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.