DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and LOC101885590

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_005172423.1 Gene:LOC101885590 / 101885590 -ID:- Length:365 Species:Danio rerio


Alignment Length:348 Identity:73/348 - (20%)
Similarity:114/348 - (32%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 DEEYESILSHISSIYI---------FPEEIQPH-------------VRHNRKVDVFRFQIDSSYS 360
            |||.|....|:|...:         .|::.:||             .|.....|....|...|..
Zfish    28 DEEEELEDRHLSKAILEMLHINKLSAPQQAKPHPYMRHVYQSLDTQAREQSAADGMLVQSFRSVE 92

  Fly   361 DLSYATLHLYLRGWDWISAHQPG---------LLEEIKKQPRKDIVVTIHRAIRVANTTSFNPKV 416
            |..|.|     .||.|.:..|..         ||.:........:.||:|.....|...|.:..:
Zfish    93 DSKYGT-----PGWIWFNTSQLSPFMRVAELVLLRKTLYHRPLSVTVTVHSLSPGAENLSISGPL 152

  Fly   417 --KMFEFRHSIPSGLGQWVAVDLKSLLGNLGSNMTQEIL--------IKGA----ETWMKSLVVT 467
              .:.......|||   :...|:.:.|.....|  .:||        ..|:    |...:||...
Zfish   153 AEHLLSLDRLPPSG---YDVFDVTAALNQPSQN--SDILGFQLRFEDESGSLVLHEALTQSLYCL 212

  Fly   468 TDNTSKNPLTVHIEIGSQKKHRRKRSVYMDCTENDHDMR-------------------CCR-YPL 512
            ..::...||.|....||.:.|:....|     .:||..|                   .|| |..
Zfish   213 NGSSVSQPLLVAYRSGSMELHQGSSGV-----GSDHKQRQRIDSERQRIHLRHGRHVGACRLYVH 272

  Fly   513 KVNF-TSFGWHFVVAPTSFDAYFCSGDC--KVGYLEQYPHTHLAALTTSATPCCSPTKMSSLSLL 574
            .|:. ||....:::.|::|....|.|.|  :.....|....|.....:.....|:|..:|||.::
Zfish   273 HVSLHTSKLSQWILQPSNFSISICRGICLKETSMTVQRQRKHQKENESLQRSACTPQGLSSLIVM 337

  Fly   575 YFDDNHNLVLSVIPNMSVEGCSC 597
            |..|..::::..:.:|..|.|.|
Zfish   338 YSSDTADIIIKELKDMRAERCEC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 24/113 (21%)
LOC101885590XP_005172423.1 TGFb_propeptide 42..225 CDD:279078 36/192 (19%)
TGF_beta 267..360 CDD:278448 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.