DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and nodal3.4

DIOPT Version :10

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001297040.1 Gene:nodal3.4 / 101732995 XenbaseID:XB-GENE-29086643 Length:401 Species:Xenopus tropicalis


Alignment Length:100 Identity:33/100 - (33%)
Similarity:49/100 - (49%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 RCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCKVGYLEQYPHTHL----AALTTSAT----- 560
            :|.:..:.|:|...|| .::|.|.:::||.|...|.|...|....|:.    :.|..|.|     
 Frog   298 KCRKVDMFVDFQKIGWGSWIVYPKAYNAYRCESACAVPLNETDDATNYSYIKSLLPLSDTERREC 362

  Fly   561 PCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGC 595
            |.|.|.||.|:|:||: :|.:.||.....|.||.|
 Frog   363 PSCVPVKMRSMSMLYY-ENEDFVLRHHEEMIVEEC 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta_GDF8_like 506..597 CDD:381629 32/99 (32%)
nodal3.4NP_001297040.1 TGFb_propeptide 53..>139 CDD:480997
TGF_beta_SF 299..397 CDD:477357 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.