DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and gdf9

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_002935305.1 Gene:gdf9 / 100496740 XenbaseID:XB-GENE-478149 Length:421 Species:Xenopus tropicalis


Alignment Length:428 Identity:74/428 - (17%)
Similarity:154/428 - (35%) Gaps:127/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSINDTYGDHIMTDFFDESSSSQMQGDDANTVN----EFLIDLNKNQAKKSDIPINTNDEEYESI 324
            |..::.|.  ::...|.|.|......|:|...|    :::..|.|..|.|...|....:..|   
 Frog    26 LEYSEDYS--LLPPLFKELSERPKWSDNAPGPNMVAIKYMKRLYKMSATKEGFPRLHKNPVY--- 85

  Fly   325 LSHISSIYIFPEEIQPHVRHNRKVDVFRFQIDSSYSDLSYATLHLYLRGWDWISAHQPGLLEEIK 389
                :::.:|....:......|:::.....:|.::|             .|.:||.:. ||:.: 
 Frog    86 ----NTVRLFTPRTECKPEREREINGGMQSLDLTFS-------------VDRVSAVEQ-LLQSL- 131

  Fly   390 KQPRKDIVVTIHRAIRVAN-TTSFNPKVKMFEFRHSI----PSGL-------GQWVAVDLKSLLG 442
                  ::.::.:....:| |.:.:.::..:|.:.::    |...       .:||.:|:.|:|.
 Frog   132 ------LLYSVSKRFSSSNITCTCSLEILGYELQSTVCPRAPQSFHFQLRKRQRWVEIDVTSILQ 190

  Fly   443 NLGSNMTQEILIKGAETWMK--------------------SLVVTTDNTS-------------KN 474
            ...||..|.|.:....|.||                    ||::..::||             :.
 Frog   191 PFISNKRQNIHLGLNFTCMKNNKHYDFATTGPFKMTRSPPSLLLYLNDTSNKAYHRRIMHDIAEQ 255

  Fly   475 PLTVHIEIGS--------------QKKHRRKR---------------------SVYMDCTENDHD 504
            ||  :..:|.              |:..||:|                     |.|:......|:
 Frog   256 PL--YYPVGRIPSILADDEGNLKLQQMSRRRRNHDYEAILEENTTVVPHTFNFSEYLKQFVYSHN 318

  Fly   505 MRCCRYPLKVNFTSFGW-HFVVAPTSFDAYFCSGDCK--VGYLEQYP-HTHLAAL------TTSA 559
             .|..:..:::|:...| .:::||..:...:|.|.|.  ||:....| ||.:..:      ::..
 Frog   319 -ECELHRFRLSFSQLNWDKWILAPHRYSPDYCKGVCPRIVGHRYGSPVHTIVQNIIYEKVDSSIP 382

  Fly   560 TPCCSPTKMSSLSLLYFDDNHNLVLSVIPNMSVEGCSC 597
            .|.|.|::...:|:|..:.::::......:|....|:|
 Frog   383 RPSCVPSEYRPMSVLTIEPDNSIAYKEYQDMIATKCTC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 20/100 (20%)
gdf9XP_002935305.1 TGF_beta_GDF9 318..421 CDD:381673 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.