DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myo and LOC100329520

DIOPT Version :9

Sequence 1:NP_726604.1 Gene:myo / 43811 FlyBaseID:FBgn0026199 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_002662616.2 Gene:LOC100329520 / 100329520 -ID:- Length:368 Species:Danio rerio


Alignment Length:412 Identity:81/412 - (19%)
Similarity:149/412 - (36%) Gaps:111/412 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 IESIKMHILMRLNLKKLPNITKPISVPQNIIDNFYRDYNASSKTTVWNRMESIDESHLSINDTYG 271
            :|..|..||.:|:|::.||||:  :||:..:....|..:|       .|:.......|. |:...
Zfish    48 VEIAKQQILSKLHLRERPNITQ--TVPRAALMTALRKLHA-------GRIRQDGTLELE-NNLPN 102

  Fly   272 DHIMTDFFDESSSSQMQGDDANTVNEFLIDLNKNQAKKSDIPINTNDEEYESILSHISSIYIFPE 336
            .......::..|.:.:.||..|:::..|                                     
Zfish   103 SRSSNQAYEIVSFADIDGDLPNSIDTSL------------------------------------- 130

  Fly   337 EIQPHVRHNRKVDVFRFQIDSSYS-DLSYATLHLYLRGWDWISAHQPGLLEEIKKQPRKDIVVTI 400
                         .|:|..:..:| .:..::|.||||         |.....|..:         
Zfish   131 -------------SFQFLQEKGHSVQVLQSSLWLYLR---------PSESSRISAE--------- 164

  Fly   401 HRAIRVANTTSFNPKVKMFEFRHSIPSGLGQW----VAVDLKSLLGNLGSNMTQEILIKGAETWM 461
               |.::::|:     :....:.|:.:..|.|    |...|::.|......:..|:..:.|...:
Zfish   165 ---IYLSDSTN-----RTLVLQRSVDAARGGWHTFPVTSTLQAFLDGGQRRLRLEVQCQDAGRNL 221

  Fly   462 KSLVVTTDNTSKNPLTVHIEIGSQ-KKHR-RKRSVYMDCTENDHDMRCCRYPLKVNFTSFGWH-F 523
            .....|.|::.:..|...:.:... .||. .|||  :.|  .|....||:....:.|....|. :
Zfish   222 CKKEPTEDSSHQPFLVAQVRLREDPSKHALSKRS--LRC--GDDVTVCCKKDFYIKFRDIQWQDW 282

  Fly   524 VVAPTSFDAYFCSGDCKVGYLEQYP----------HTHLAA--LTTSATPCCSPTKMSSLSLLYF 576
            ::||..:...:|.|.|. .:|...|          .:.|.|  :.|:.:.||.|.:...||::||
Zfish   283 IIAPEGYHMNYCMGQCP-QHLSGSPGIASSFHASVFSQLKANGINTAVSSCCVPIQRRPLSMVYF 346

  Fly   577 DDNHNLVLSVIPNMSVEGCSCS 598
            :..|.:|.:.:|:|.||.|.|:
Zfish   347 NSQHTIVKTDVPDMIVESCGCT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myoNP_726604.1 TGF_beta 506..597 CDD:278448 28/103 (27%)
LOC100329520XP_002662616.2 TGFb_propeptide 54..238 CDD:279078 43/269 (16%)
TGF_beta 265..367 CDD:278448 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.