DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ekar and Ir75c

DIOPT Version :9

Sequence 1:NP_001036250.1 Gene:Ekar / 43806 FlyBaseID:FBgn0039916 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster


Alignment Length:381 Identity:65/381 - (17%)
Similarity:148/381 - (38%) Gaps:51/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 GEWN------GMVAQLMKYKADLAVGSMTITYARESVIDFTKPF---MNLGISILFKVPTSEPTR 522
            |.|:      |.:..|....|:|.......::.|   :.:..|.   .......:|:.|.:...:
  Fly   256 GTWSVQDAFGGAIGMLTNESAELCTTPFVPSWNR---LHYLHPMTEQAQFRAVCMFRTPHNAGIK 317

  Fly   523 LFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEW--KCINACDLENISIGNQFSLTDSFWF 585
            ...|:.|....:|...........:.::::..|.. .|  :|::...          ||..|...
  Fly   318 AAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLER-HWMQRCLDFIP----------SLLSSCLI 371

  Fly   586 TIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLA-SQT 649
            :.|....|...:.|::...|:........|.::...||:.:.:.|....:.:.|...:.|| |..
  Fly   372 SFGAACIQGSYLMPKSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSL 436

  Fly   650 EISYGTLDSGSTMTFF----RDSVIETYKKIWRSMDNKK-PSAFTTTYEDGIKRV-NQGNYAFLM 708
            ::.:.|:.  .|.|:.    |..:...||   :.:::|: |::...:.|:|:.|| :|..:.:..
  Fly   437 DVGFDTVP--FTKTYLVSSPRPDIRSLYK---QKVESKRDPNSVWLSPEEGVIRVRDQPGFVYTS 496

  Fly   709 ESTMLDYIVQRD------CNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYD 767
            |::.:.:.|::.      .:|.:|....::..||: ....|.:|..::...:.:.|.| |.....
  Fly   497 EASFMYHFVEKHYLPREISDLNEIILRPESAVYGM-VHLNSTYRQLLTQLQVRMLETG-ITSKQS 559

  Fly   768 KWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEF-WYNF 822
            :::..     |:.:|...|....:|:|....:|:.|:....:|.::...|. |..:
  Fly   560 RFFSK-----TKLHTFSNSFVIQVGMEYAAPLFISLLVAYFLALLILILEICWARY 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EkarNP_001036250.1 PBP1_iGluR_Kainate 24..388 CDD:107377
ANF_receptor 39..371 CDD:279440
PBP2_iGluR_Kainate 402..771 CDD:270432 55/327 (17%)
Lig_chan 533..807 CDD:278489 50/288 (17%)
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 41/241 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.